CacheBy
Atlas Antibodies Anti-TPRA1 Antibody
원본

Atlas Antibodies Anti-TPRA1 Antibody

상품 한눈에 보기

Human TPRA1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. FLJ32197, GPR175 등 대체 유전자명과 교차 반응 정보 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019784-100 Anti-TPRA1 Antibody, transmembrane protein, adipocyte asscociated 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019784-25 Anti-TPRA1 Antibody, transmembrane protein, adipocyte asscociated 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TPRA1 Antibody

Anti-TPRA1 Antibody

Target: transmembrane protein, adipocyte associated 1 (TPRA1)
Product Type: Polyclonal Antibody against Human TPRA1

  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against human TPRA1 (transmembrane protein, adipocyte associated 1).

Alternative Gene Names

FLJ32197, GPR175, TMEM227, TPRA40

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein transmembrane protein, adipocyte associated 1
Target Gene TPRA1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
MDTLEEVTWANGSTALPPPLAPNISVPHRCLLLLYEDIGTSR
Verified Species Reactivity Human
Interspecies Identity Mouse: 71% (ENSMUSG00000002871)
Rat: 64% (ENSRNOG00000016665)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자에 의해 결정되어야 합니다.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.