
Atlas Antibodies Anti-TPRA1 Antibody
상품 한눈에 보기
Human TPRA1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. FLJ32197, GPR175 등 대체 유전자명과 교차 반응 정보 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TPRA1 Antibody
Target: transmembrane protein, adipocyte associated 1 (TPRA1)
Product Type: Polyclonal Antibody against Human TPRA1
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against human TPRA1 (transmembrane protein, adipocyte associated 1).
Alternative Gene Names
FLJ32197, GPR175, TMEM227, TPRA40
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transmembrane protein, adipocyte associated 1 |
| Target Gene | TPRA1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MDTLEEVTWANGSTALPPPLAPNISVPHRCLLLLYEDIGTSR |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse: 71% (ENSMUSG00000002871) Rat: 64% (ENSRNOG00000016665) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자에 의해 결정되어야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
