
원본
Atlas Antibodies Anti-TPRA1 Antibody
상품 한눈에 보기
Human TPRA1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. FLJ32197, GPR175 등 대체 유전자명과 교차 반응 정보 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA019784-100 Anti-TPRA1 Antibody, transmembrane protein, adipocyte asscociated 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019784-25 Anti-TPRA1 Antibody, transmembrane protein, adipocyte asscociated 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TPRA1 Antibody
Anti-TPRA1 Antibody
Target: transmembrane protein, adipocyte associated 1 (TPRA1)
Product Type: Polyclonal Antibody against Human TPRA1
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against human TPRA1 (transmembrane protein, adipocyte associated 1).
Alternative Gene Names
FLJ32197, GPR175, TMEM227, TPRA40
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transmembrane protein, adipocyte associated 1 |
| Target Gene | TPRA1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MDTLEEVTWANGSTALPPPLAPNISVPHRCLLLLYEDIGTSR |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse: 71% (ENSMUSG00000002871) Rat: 64% (ENSRNOG00000016665) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자에 의해 결정되어야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



