
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TPR Antibody
상품 한눈에 보기
Human TPR 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 대한 검증 완료 및 독립 항체 비교로 신뢰성 향상.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA024336-100 Anti-TPR Antibody, translocated promoter region, nuclear basket protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024336-25 Anti-TPR Antibody, translocated promoter region, nuclear basket protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TPR Antibody
Anti-TPR Antibody
translocated promoter region, nuclear basket protein
Recommended Applications
- IHC (Independent antibody validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human TPR
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | translocated promoter region, nuclear basket protein |
| Target Gene | TPR |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KMASVRQHLEETTQKAESQLLECKASWEERERMLKDEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQE |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000002394 (90%)
- Mouse ENSMUSG00000006005 (88%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



