
Atlas Antibodies Anti-TOP2A Antibody
상품 한눈에 보기
Human TOP2A 단백질을 인식하는 토포이소머라제 II 알파(170kDa) 폴리클로날 항체. IHC 및 WB에 적합하며, RNA-seq 데이터 기반 직교 검증 완료. Rabbit 유래 IgG로, PrEST 항원을 이용해 친화 정제됨. 40% glycerol/PBS buffer에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TOP2A Antibody
Target Protein: topoisomerase (DNA) II alpha 170kDa
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation)
- WB (Western Blot)
Orthogonal validation:
Protein expression verified using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human TOP2A.
Alternative Gene Names
TOP2
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Amino Acid Sequence:
DASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKG
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000020914 | 63% |
| Rat | ENSRNOG00000053047 | 60% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TOP1MT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TONSL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOP2A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOMM70 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOMM70 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.