
Atlas Antibodies Anti-TOMM70 Antibody
상품 한눈에 보기
Human TOMM70 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등에 사용 가능. Orthogonal validation으로 검증됨. 고순도 Affinity purification 방식으로 제조되어 높은 특이성과 재현성을 제공. Human 및 Mouse 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TOMM70 Antibody
Target: translocase of outer mitochondrial membrane 70 (TOMM70)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human TOMM70
Alternative Gene Names
KIAA0719, Tom70, TOMM70A
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | translocase of outer mitochondrial membrane 70 |
| Target Gene | TOMM70 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATT |
Verified Species Reactivity
- Human
- Mouse
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000001640 (92%)
- Mouse ENSMUSG00000022752 (92%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TONSL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOP2A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOMM70 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOMM70 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.