Atlas Antibodies Anti-TOMM70 Antibody

상품 한눈에 보기

Human TOMM70 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등에 사용 가능. Orthogonal validation으로 검증됨. 고순도 Affinity purification 방식으로 제조되어 높은 특이성과 재현성을 제공. Human 및 Mouse 반응성 확인.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA048020-100 Anti-TOMM70 Antibody, translocase of outer mitochondrial membrane 70 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA048020-25 Anti-TOMM70 Antibody, translocase of outer mitochondrial membrane 70 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TOMM70 Antibody

Anti-TOMM70 Antibody

Target: translocase of outer mitochondrial membrane 70 (TOMM70)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human TOMM70

Alternative Gene Names

KIAA0719, Tom70, TOMM70A

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	translocase of outer mitochondrial membrane 70
Target Gene	TOMM70
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATT

Verified Species Reactivity

Human
Mouse

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000001640 (92%)
Mouse ENSMUSG00000022752 (92%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand