
원본
Atlas Antibodies Anti-TNFRSF21 Antibody
상품 한눈에 보기
Human TNFRSF21을 인식하는 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. Human 종에 반응성이 검증되어 신뢰성 높은 단백질 연구에 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA006746-100 Anti-TNFRSF21 Antibody, tumor necrosis factor receptor superfamily, member 21 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006746-25 Anti-TNFRSF21 Antibody, tumor necrosis factor receptor superfamily, member 21 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TNFRSF21 Antibody
Anti-TNFRSF21 Antibody
Target: Tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
Type: Polyclonal Antibody against Human TNFRSF21
Supplier: Atlas Antibodies
Alternative Gene Names
CD358, DR6
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) with recombinant expression validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody targeting human TNFRSF21. Validated for recombinant expression and IHC applications.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Tumor necrosis factor receptor superfamily, member 21 |
| Target Gene | TNFRSF21 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (86%), Rat (85%) |
Antigen Sequence:
PVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTLPSFSSSTS
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



