
Atlas Antibodies Anti-TNFRSF21 Antibody
Human TNFRSF21을 인식하는 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. Human 종에 반응성이 검증되어 신뢰성 높은 단백질 연구에 활용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TNFRSF21 Antibody
Target: Tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
Type: Polyclonal Antibody against Human TNFRSF21
Supplier: Atlas Antibodies
Alternative Gene Names
CD358, DR6
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) with recombinant expression validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody targeting human TNFRSF21. Validated for recombinant expression and IHC applications.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Tumor necrosis factor receptor superfamily, member 21 |
| Target Gene | TNFRSF21 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (86%), Rat (85%) |
Antigen Sequence:
PVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTLPSFSSSTS
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TNFRSF8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNFRSF6B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNFRSF21 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNFRSF8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNFRSF1B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|