CacheBy
Atlas Antibodies Anti-TNFRSF1B Antibody
원본

Atlas Antibodies Anti-TNFRSF1B Antibody

상품 한눈에 보기

인간 TNFRSF1B 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 응용에 적합합니다. Rabbit에서 생산된 IgG 형이며 PrEST 항원으로 정제되었습니다. 높은 특이성과 재현성을 제공하며 다양한 연구용으로 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA004796-100 Anti-TNFRSF1B Antibody, tumor necrosis factor receptor superfamily, member 1B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004796-25 Anti-TNFRSF1B Antibody, tumor necrosis factor receptor superfamily, member 1B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TNFRSF1B Antibody

Anti-TNFRSF1B Antibody

Target Information

  • Protein: Tumor necrosis factor receptor superfamily, member 1B
  • Gene: TNFRSF1B
  • Alternative Gene Names: CD120b, p75, TNF-R-II, TNF-R75, TNFBR, TNFR2, TNFR80
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human TNFRSF1B.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000028599): 59%
  • Rat (ENSRNOG00000016575): 59%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Information

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.