Atlas Antibodies Anti-TMTC4 Antibody

상품 한눈에 보기

Human TMTC4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤 기반 완충액에 보존제가 포함되어 있습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA016489-100 Anti-TMTC4 Antibody, transmembrane and tetratricopeptide repeat containing 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA016489-25 Anti-TMTC4 Antibody, transmembrane and tetratricopeptide repeat containing 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TMTC4 Antibody

Anti-TMTC4 Antibody

Target: transmembrane and tetratricopeptide repeat containing 4 (TMTC4)
Type: Polyclonal Antibody against Human TMTC4

Recommended Applications

Immunohistochemistry (IHC)
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human TMTC4 protein.
Validated for human reactivity and designed using PrEST recombinant antigen sequence.

Alternative Gene Names

FLJ14624, FLJ22153

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	transmembrane and tetratricopeptide repeat containing 4
Target Gene	TMTC4
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	NLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLLR
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000041594 (96%), Rat ENSRNOG00000014310 (94%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet