
Atlas Antibodies Anti-TMTC4 Antibody
상품 한눈에 보기
Human TMTC4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤 기반 완충액에 보존제가 포함되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TMTC4 Antibody
Target: transmembrane and tetratricopeptide repeat containing 4 (TMTC4)
Type: Polyclonal Antibody against Human TMTC4
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human TMTC4 protein.
Validated for human reactivity and designed using PrEST recombinant antigen sequence.
Alternative Gene Names
FLJ14624, FLJ22153
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transmembrane and tetratricopeptide repeat containing 4 |
| Target Gene | TMTC4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLLR |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000041594 (96%), Rat ENSRNOG00000014310 (94%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TMUB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMUB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMTC4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMTC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMSB15B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.