CacheBy
Atlas Antibodies Anti-TMTC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMTC1 Antibody

상품 한눈에 보기

Human TMTC1 단백질을 타겟으로 하는 폴리클로날 래빗 항체. IHC, WB, ICC 등 다양한 응용에 적합. 높은 종간 특이성과 친화 정제 방식으로 제작. 안정적인 PBS/glycerol 버퍼에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA016720-100 Anti-TMTC1 Antibody, transmembrane and tetratricopeptide repeat containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016720-25 Anti-TMTC1 Antibody, transmembrane and tetratricopeptide repeat containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMTC1 Antibody

Anti-TMTC1 Antibody

Target: Transmembrane and tetratricopeptide repeat containing 1 (TMTC1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TMTC1.


Alternative Gene Names

ARG99, FLJ31400, FLJ41625, OLF


Target Information

항목 내용
Target Protein Transmembrane and tetratricopeptide repeat containing 1
Target Gene TMTC1
Verified Species Reactivity Human
Interspecies Identity Mouse (78%), Rat (74%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GITVFGVCLVYDLFSLSNKQDKSSNGALCPRSPQQPGSPQPSSLPGHPHRENGKQQRFPHKGAWGGCHSPLPPEPKSSGFPVSPRAVWSMMR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (HPA016720)


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.