Atlas Antibodies Anti-GCG Antibody

상품 한눈에 보기

Human GCG(glucagon) 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 분석에 적합합니다. RNA-seq 데이터 기반 Orthogonal Validation으로 검증되었으며, PrEST 항원을 이용해 친화 정제되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036760-100 Anti-GCG Antibody, glucagon 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036760-25 Anti-GCG Antibody, glucagon 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: glucagon (GCG)
Clonality: Polyclonal
Host: Rabbit
Validated Applications: IHC, ICC

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against human GCG (glucagon). Validated for use in immunohistochemistry and immunocytochemistry.

GLP1, GLP2, GRPP

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEF

Verified Species: Human
Interspecies Identity:
- Rat ENSRNOG00000005498 (85%)
- Mouse ENSMUSG00000000394 (85%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage	Store at -20°C
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.
Safety	Material Safety Data Sheet