
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GCG Antibody
상품 한눈에 보기
Human GCG(glucagon) 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 분석에 적합합니다. RNA-seq 데이터 기반 Orthogonal Validation으로 검증되었으며, PrEST 항원을 이용해 친화 정제되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036760-100 Anti-GCG Antibody, glucagon 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036760-25 Anti-GCG Antibody, glucagon 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GCG Antibody
Anti-GCG Antibody
Target: glucagon (GCG)
Clonality: Polyclonal
Host: Rabbit
Validated Applications: IHC, ICC
Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human GCG (glucagon). Validated for use in immunohistochemistry and immunocytochemistry.
Alternative Gene Names
GLP1, GLP2, GRPP
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEF
Species Reactivity
- Verified Species: Human
- Interspecies Identity:
- Rat ENSRNOG00000005498 (85%)
- Mouse ENSMUSG00000000394 (85%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Storage | Store at -20°C |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety | Material Safety Data Sheet |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



