
Atlas Antibodies Anti-GCG Antibody
상품 한눈에 보기
Human GCG(glucagon) 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 ICC 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 제품이며, PrEST 항원을 이용해 affinity purification되었습니다. GLP1, GLP2, GRPP 등 관련 유전자에 대응합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GCG Antibody
Target Information
- Target Protein: Glucagon
- Target Gene: GCG
- Alternative Gene Names: GLP1, GLP2, GRPP
Recommended Applications
- IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human GCG.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEF
Species Reactivity
- Verified Reactivity: Human
- Interspecies Information:
- Rat ENSRNOG00000005498 (85%)
- Mouse ENSMUSG00000000394 (85%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
