
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GARS Antibody
상품 한눈에 보기
Human GARS(glycyl-tRNA synthetase)를 표적으로 하는 rabbit polyclonal antibody로, IHC와 WB에서 독립 항체 검증을 통해 높은 신뢰성을 확보. Affinity purification으로 높은 특이성과 재현성 제공. Human에 반응하며 ICC에도 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA017896-100 Anti-GARS Antibody, glycyl-tRNA synthetase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017896-25 Anti-GARS Antibody, glycyl-tRNA synthetase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GARS Antibody
Anti-GARS Antibody
Target Protein: glycyl-tRNA synthetase
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human GARS (glycyl-tRNA synthetase)
Alternative Gene Names
CMT2D, DSMAV, GlyRS, SMAD1
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | glycyl-tRNA synthetase |
| Target Gene | GARS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000029777 (96%), Rat ENSRNOG00000011052 (96%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Antigen Sequence
KLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQINotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



