CacheBy
Atlas Antibodies Anti-GARS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GARS Antibody

상품 한눈에 보기

Human GARS(glycyl-tRNA synthetase)를 표적으로 하는 rabbit polyclonal antibody로, IHC와 WB에서 독립 항체 검증을 통해 높은 신뢰성을 확보. Affinity purification으로 높은 특이성과 재현성 제공. Human에 반응하며 ICC에도 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017896-100 Anti-GARS Antibody, glycyl-tRNA synthetase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017896-25 Anti-GARS Antibody, glycyl-tRNA synthetase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GARS Antibody

Anti-GARS Antibody

Target Protein: glycyl-tRNA synthetase
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human GARS (glycyl-tRNA synthetase)

Alternative Gene Names

CMT2D, DSMAV, GlyRS, SMAD1

Open Datasheet


Specifications

항목 내용
Target Protein glycyl-tRNA synthetase
Target Gene GARS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000029777 (96%), Rat ENSRNOG00000011052 (96%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Antigen Sequence

KLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQI

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.