CacheBy
Atlas Antibodies Anti-GALP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GALP Antibody

상품 한눈에 보기

Human GALP에 대한 고품질 rabbit polyclonal antibody. IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식. 인간 종에 대해 검증된 반응성. 안정적인 PBS/glycerol buffer 포맷.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053938-100 Anti-GALP Antibody, galanin-like peptide 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053938-25 Anti-GALP Antibody, galanin-like peptide 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GALP Antibody

Anti-GALP Antibody

Target: Galanin-like peptide (GALP)
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal antibody against human GALP.
Affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet


Target Information

항목 내용
Target Protein Galanin-like peptide
Target Gene GALP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000022129 (59%)
  • Mouse ENSMUSG00000034660 (59%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.