Atlas Antibodies Anti-GALNT7 Antibody

상품 한눈에 보기

Human GALNT7 단백질을 인식하는 고품질 Rabbit Polyclonal 항체. IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal validation으로 RNA-seq 데이터와 비교 검증된 신뢰성 높은 제품. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA064243-100 Anti-GALNT7 Antibody, polypeptide N-acetylgalactosaminyltransferase 7 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA064243-25 Anti-GALNT7 Antibody, polypeptide N-acetylgalactosaminyltransferase 7 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GALNT7 Antibody

Anti-GALNT7 Antibody

polypeptide N-acetylgalactosaminyltransferase 7

Recommended Applications

Immunohistochemistry (IHC) – Orthogonal validation of protein expression using comparison to RNA-seq data in high and low expression tissues
Western Blot (WB)
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human GALNT7

Alternative Gene Names

GALNAC-T7

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	polypeptide N-acetylgalactosaminyltransferase 7
Target Gene	GALNT7
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000012037 (89%), Mouse ENSMUSG00000031608 (88%)

Antigen Sequence (PrEST):
GDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKRAI

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand