
Atlas Antibodies Anti-GALNT16 Antibody
상품 한눈에 보기
Human GALNT16 단백질을 인식하는 rabbit polyclonal antibody. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. GALNT16의 대체 유전자명 GalNAc-T16, GALNTL1, KIAA1130을 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GALNT16 Antibody
개요
Polyclonal Antibody against Human GALNT16 (polypeptide N-acetylgalactosaminyltransferase 16)
권장 응용 분야
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
제품 설명
Rabbit polyclonal antibody targeting human GALNT16 protein, affinity purified using PrEST antigen.
대체 유전자명
GalNAc-T16, GALNTL1, KIAA1130
표적 단백질 정보
| 항목 | 내용 |
|---|---|
| Target Protein | polypeptide N-acetylgalactosaminyltransferase 16 |
| Target Gene | GALNT16 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (96%), Rat (94%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
ATSTLMSSPGSPVILQMCNPREGKQKWRRKGSFIQHSVSGLCLETKPAQLVTSKCQADAQAQQWQLLPH주의사항
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 목적에 맞게 설정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GALNT7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GALNT6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GALNT16 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GALNT5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GALNT5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.