Atlas Antibodies Anti-GAL3ST2 Antibody

상품 한눈에 보기

Human GAL3ST2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 기반 정교한 orthogonal 검증 수행. Affinity purified 방식으로 높은 특이성과 재현성 확보. 다양한 조직에서 GAL3ST2 발현 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA071809-100 Anti-GAL3ST2 Antibody, galactose-3-O-sulfotransferase 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA071809-25 Anti-GAL3ST2 Antibody, galactose-3-O-sulfotransferase 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: galactose-3-O-sulfotransferase 2 (GAL3ST2)
Type: Polyclonal Antibody against Human GAL3ST2

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody raised in rabbit against human GAL3ST2.
Validated for immunohistochemistry (IHC) with orthogonal verification.

항목	내용
Target Protein	galactose-3-O-sulfotransferase 2
Target Gene	GAL3ST2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	YAKNNMWFDFGFDPNAQCEEGYVRARIAEVERRFRLVLIAEHLDESLVLL

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000093805	72%
Rat	ENSRNOG00000022982	68%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)