
Atlas Antibodies Anti-GADD45B Antibody
상품 한눈에 보기
Human GADD45B 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 분석에 적합. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화 정제됨. 고순도 및 높은 특이성을 제공하며, 다양한 연구 응용에 활용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GADD45B Antibody
Target: growth arrest and DNA-damage-inducible, beta (GADD45B)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human GADD45B protein, generated using a recombinant PrEST antigen sequence.
Alternative Gene Names
DKFZP566B133, GADD45BETA, MYD118
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | growth arrest and DNA-damage-inducible, beta |
| Target Gene | GADD45B |
| Antigen Sequence | AVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPY |
| Verified Species Reactivity | Human |
| Ortholog Identity | Mouse (95%), Rat (94%) |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Host | Rabbit |
| Isotype | IgG |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GABRG3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GAD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GADD45B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GAD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GABRG1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.