CacheBy
Atlas Antibodies Anti-GABRG3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GABRG3 Antibody

상품 한눈에 보기

인간 GABRG3 단백질을 표적으로 하는 폴리클로날 항체입니다. 토끼 유래 IgG로 제작되었으며, PrEST 항원으로 친화정제되었습니다. 인체 반응성이 검증되어 있으며, IHC 등 다양한 응용에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054010-100 Anti-GABRG3 Antibody, gamma-aminobutyric acid (GABA) A receptor, gamma 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054010-25 Anti-GABRG3 Antibody, gamma-aminobutyric acid (GABA) A receptor, gamma 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GABRG3 Antibody

Anti-GABRG3 Antibody

Target: gamma-aminobutyric acid (GABA) A receptor, gamma 3
Supplier: Atlas Antibodies


면역조직화학(IHC)


Product Description

Polyclonal Antibody against Human GABRG3
Open Datasheet


Target Information

항목 내용
Target Protein gamma-aminobutyric acid (GABA) A receptor, gamma 3
Target Gene GABRG3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000055026 (93%), Rat ENSRNOG00000014862 (91%)

Antigen Sequence:
ARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYD


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.