
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GABRE Antibody
상품 한눈에 보기
인간 GABRE 단백질을 인식하는 토끼 폴리클로날 항체로, GABA A 수용체 엡실론 서브유닛 검출에 사용됩니다. IHC 등 다양한 응용에 적합하며, 친화 정제된 고품질 항체입니다. PBS와 글리세롤 완충액에 보존되어 안정성이 우수합니다.
- 카탈로그번호
- HPA045918-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA045918-100 Anti-GABRE Antibody, gamma-aminobutyric acid (GABA) A receptor, epsilon 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045918-25 Anti-GABRE Antibody, gamma-aminobutyric acid (GABA) A receptor, epsilon 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GABRE Antibody
Anti-GABRE Antibody
Target Information
- Target Protein: gamma-aminobutyric acid (GABA) A receptor, epsilon
- Target Gene: GABRE
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEIAVNSLGPL - Verified Species Reactivity: Human
- Interspecies Information:
- Rat ENSRNOG00000061182 (60%)
- Mouse ENSMUSG00000031340 (58%)
Product Description
Polyclonal antibody against Human GABRE, suitable for applications such as immunohistochemistry (IHC).
Open Datasheet
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Storage | Store at recommended temperature. Mix gently before use. |
| Notes | Optimal concentrations and conditions for each application should be determined by the user. |
| Safety | Material Safety Data Sheet |
Recommended Applications
- Immunohistochemistry (IHC)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



