
Atlas Antibodies Anti-GABRE Antibody
상품 한눈에 보기
인간 GABRE 단백질을 인식하는 토끼 폴리클로날 항체로, GABA A 수용체 엡실론 서브유닛 검출에 사용됩니다. IHC 등 다양한 응용에 적합하며, 친화 정제된 고품질 항체입니다. PBS와 글리세롤 완충액에 보존되어 안정성이 우수합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GABRE Antibody
Target Information
- Target Protein: gamma-aminobutyric acid (GABA) A receptor, epsilon
- Target Gene: GABRE
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEIAVNSLGPL - Verified Species Reactivity: Human
- Interspecies Information:
- Rat ENSRNOG00000061182 (60%)
- Mouse ENSMUSG00000031340 (58%)
Product Description
Polyclonal antibody against Human GABRE, suitable for applications such as immunohistochemistry (IHC).
Open Datasheet
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Storage | Store at recommended temperature. Mix gently before use. |
| Notes | Optimal concentrations and conditions for each application should be determined by the user. |
| Safety | Material Safety Data Sheet |
Recommended Applications
- Immunohistochemistry (IHC)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GABPB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GABRB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GABRE Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GABPB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GABRA3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.