CacheBy
Atlas Antibodies Anti-GABRE Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GABRE Antibody

상품 한눈에 보기

인간 GABRE 단백질을 인식하는 토끼 폴리클로날 항체로, GABA A 수용체 엡실론 서브유닛 검출에 사용됩니다. IHC 등 다양한 응용에 적합하며, 친화 정제된 고품질 항체입니다. PBS와 글리세롤 완충액에 보존되어 안정성이 우수합니다.

카탈로그번호
HPA045918-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045918-100 Anti-GABRE Antibody, gamma-aminobutyric acid (GABA) A receptor, epsilon 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045918-25 Anti-GABRE Antibody, gamma-aminobutyric acid (GABA) A receptor, epsilon 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GABRE Antibody

Anti-GABRE Antibody

Target Information

  • Target Protein: gamma-aminobutyric acid (GABA) A receptor, epsilon
  • Target Gene: GABRE
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    PQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEIAVNSLGPL
  • Verified Species Reactivity: Human
  • Interspecies Information:
    • Rat ENSRNOG00000061182 (60%)
    • Mouse ENSMUSG00000031340 (58%)

Product Description

Polyclonal antibody against Human GABRE, suitable for applications such as immunohistochemistry (IHC).
Open Datasheet

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Storage Store at recommended temperature. Mix gently before use.
Notes Optimal concentrations and conditions for each application should be determined by the user.
Safety Material Safety Data Sheet
  • Immunohistochemistry (IHC)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.