CacheBy
Atlas Antibodies Anti-GABRA3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GABRA3 Antibody

상품 한눈에 보기

인간 GABRA3 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며 인체 및 마우스 반응성 검증. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤/PBS 완충액에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000839-100 Anti-GABRA3 Antibody, gamma-aminobutyric acid (GABA) A receptor, alpha 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000839-25 Anti-GABRA3 Antibody, gamma-aminobutyric acid (GABA) A receptor, alpha 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GABRA3 Antibody

Anti-GABRA3 Antibody

Target: gamma-aminobutyric acid (GABA) A receptor, alpha 3
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human GABRA3.

Open Datasheet


Target Information

항목 내용
Target Protein gamma-aminobutyric acid (GABA) A receptor, alpha 3
Target Gene GABRA3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TSHCYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDE

Verified Species Reactivity

  • Human
  • Mouse

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000056558 (93%)
  • Mouse ENSMUSG00000031343 (91%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.