
Atlas Antibodies Anti-FUCA2 Antibody
상품 한눈에 보기
Human FUCA2 단백질을 인식하는 Rabbit Polyclonal 항체로, fucosidase alpha-L-2(plasma) 검출에 적합. Affinity purification 방식으로 고순도 확보. IHC 등 다양한 응용에 사용 가능. Human에 특이적으로 반응하며, Mouse 및 Rat과 높은 서열 유사성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-FUCA2 Antibody
Target Protein: fucosidase, alpha-L-2, plasma
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against Human FUCA2.
Alternative Gene Names: dJ20N2.5, MGC1314
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
ELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDG
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000019810): 88%
- Rat (ENSRNOG00000015551): 85%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Recommended Applications | Immunohistochemistry (IHC) and other validated assays |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-FUNDC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FUNDC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FUCA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FUOM Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FUCA1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.