CacheBy
Atlas Antibodies Anti-FUCA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FUCA2 Antibody

상품 한눈에 보기

Human FUCA2 단백질을 인식하는 Rabbit Polyclonal 항체로, fucosidase alpha-L-2(plasma) 검출에 적합. Affinity purification 방식으로 고순도 확보. IHC 등 다양한 응용에 사용 가능. Human에 특이적으로 반응하며, Mouse 및 Rat과 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031659-100 Anti-FUCA2 Antibody, fucosidase, alpha-L- 2, plasma 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031659-25 Anti-FUCA2 Antibody, fucosidase, alpha-L- 2, plasma 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FUCA2 Antibody

Anti-FUCA2 Antibody

Target Protein: fucosidase, alpha-L-2, plasma
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against Human FUCA2.
Alternative Gene Names: dJ20N2.5, MGC1314

Open Datasheet (PDF)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    ELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000019810): 88%
  • Rat (ENSRNOG00000015551): 85%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand
Recommended Applications Immunohistochemistry (IHC) and other validated assays

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.