
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-FUCA2 Antibody
상품 한눈에 보기
Human FUCA2 단백질을 인식하는 Rabbit Polyclonal 항체로, fucosidase alpha-L-2(plasma) 검출에 적합. Affinity purification 방식으로 고순도 확보. IHC 등 다양한 응용에 사용 가능. Human에 특이적으로 반응하며, Mouse 및 Rat과 높은 서열 유사성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031659-100 Anti-FUCA2 Antibody, fucosidase, alpha-L- 2, plasma 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031659-25 Anti-FUCA2 Antibody, fucosidase, alpha-L- 2, plasma 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FUCA2 Antibody
Anti-FUCA2 Antibody
Target Protein: fucosidase, alpha-L-2, plasma
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against Human FUCA2.
Alternative Gene Names: dJ20N2.5, MGC1314
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
ELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDG
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000019810): 88%
- Rat (ENSRNOG00000015551): 85%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Recommended Applications | Immunohistochemistry (IHC) and other validated assays |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



