CacheBy
Atlas Antibodies Anti-FUOM Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FUOM Antibody

상품 한눈에 보기

Human FUOM 단백질을 인식하는 rabbit polyclonal antibody로, fucose mutarotase 연구에 적합. Affinity purification으로 높은 특이성과 재현성 제공. IHC 등 다양한 응용 가능. Human에 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039207-100 Anti-FUOM Antibody, fucose mutarotase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039207-25 Anti-FUOM Antibody, fucose mutarotase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FUOM Antibody

Anti-FUOM Antibody

Target Information

  • Target Protein: fucose mutarotase
  • Target Gene: FUOM
  • Alternative Gene Names: C10orf125, FLJ26016, FucM, FucU

Product Description

Polyclonal antibody against human FUOM, generated in rabbit. Suitable for applications such as immunohistochemistry (IHC).

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
  • Antigen Sequence:
    MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Mouse (ENSMUSG00000025466): 87%
  • Rat (ENSRNOG00000047000): 86%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.