
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-FOXL2NB Antibody
상품 한눈에 보기
Human FOXL2NB 단백질을 인식하는 Rabbit Polyclonal 항체로, Western Blot 및 Immunocytochemistry에 적합. PrEST 항원으로 정제되었으며, 고순도의 IgG 형태로 제공. 인간 특이적 반응성을 확인함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA061017-100 Anti-FOXL2NB Antibody, FOXL2 neighbor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061017-25 Anti-FOXL2NB Antibody, FOXL2 neighbor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FOXL2NB Antibody
Anti-FOXL2NB Antibody
Overview
Polyclonal antibody against Human FOXL2NB (FOXL2 neighbor) protein.
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
- Type: Polyclonal Antibody
- Target Protein: FOXL2 neighbor
- Target Gene: FOXL2NB
- Alternative Gene Names: C3orf72, FLJ43329
- Host: Rabbit
- Isotype: IgG
- Clonality: Polyclonal
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
PALVKKRMPDACTLGRAGIGLPKMCLHMAVRHSKAQKTGPGILQQRQKPPAPRASGGPALLGKRRGCSEA
Species Reactivity
| Species | Reactivity | Identity (%) |
|---|---|---|
| Human | Verified | - |
| Mouse | Predicted | 30 |
| Rat | Predicted | 29 |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
- Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



