
Atlas Antibodies Anti-FOXL2NB Antibody
상품 한눈에 보기
Human FOXL2NB 단백질을 인식하는 Rabbit Polyclonal 항체로, Western Blot 및 Immunocytochemistry에 적합. PrEST 항원으로 정제되었으며, 고순도의 IgG 형태로 제공. 인간 특이적 반응성을 확인함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-FOXL2NB Antibody
Overview
Polyclonal antibody against Human FOXL2NB (FOXL2 neighbor) protein.
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
- Type: Polyclonal Antibody
- Target Protein: FOXL2 neighbor
- Target Gene: FOXL2NB
- Alternative Gene Names: C3orf72, FLJ43329
- Host: Rabbit
- Isotype: IgG
- Clonality: Polyclonal
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
PALVKKRMPDACTLGRAGIGLPKMCLHMAVRHSKAQKTGPGILQQRQKPPAPRASGGPALLGKRRGCSEA
Species Reactivity
| Species | Reactivity | Identity (%) |
|---|---|---|
| Human | Verified | - |
| Mouse | Predicted | 30 |
| Rat | Predicted | 29 |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
- Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-FOXN3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FOXN2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FOXL2NB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FOXK2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FOXL2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.