Atlas Antibodies Anti-FOXL2 Antibody

상품 한눈에 보기

인간 FOXL2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 분석에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, RNA-seq 데이터 기반의 직교 검증을 통해 신뢰성이 높습니다. BPES 관련 연구에 활용 가능합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA069613-100 Anti-FOXL2 Antibody, forkhead box L2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA069613-25 Anti-FOXL2 Antibody, forkhead box L2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: forkhead box L2
Supplier: Atlas Antibodies

IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC

Polyclonal Antibody against Human FOXL2

BPES, BPES1

항목	내용
Target Protein	forkhead box L2
Target Gene	FOXL2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGG
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000050397 (82%), Rat ENSRNOG00000017190 (79%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.