
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-FNBP1 Antibody
상품 한눈에 보기
Human FNBP1 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 정합 검증 완료. Rabbit 유래 IgG로, PrEST 항원 친화 정제 방식 사용. Human에 반응하며 Rat, Mouse와 높은 상동성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA019691-100 Anti-FNBP1 Antibody, formin binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019691-25 Anti-FNBP1 Antibody, formin binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FNBP1 Antibody
Anti-FNBP1 Antibody
Target: formin binding protein 1 (FNBP1)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human FNBP1.
Alternative Gene Names
FBP17, KIAA0554
Antigen Information
- Target Protein: formin binding protein 1
- Target Gene: FNBP1
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
DYTQPMKRTVSDNSLSNSRGEGKPDLKFGGKSKGKLWPFIKKNKLSLKLGATPEDFSNLPPEQ
Species Reactivity
| Species | Reactivity | Sequence Identity |
|---|---|---|
| Human | Verified | - |
| Rat | Ortholog ENSRNOG00000008258 | 89% |
| Mouse | Ortholog ENSMUSG00000075415 | 87% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



