
Atlas Antibodies Anti-FNBP1 Antibody
Human FNBP1 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 정합 검증 완료. Rabbit 유래 IgG로, PrEST 항원 친화 정제 방식 사용. Human에 반응하며 Rat, Mouse와 높은 상동성 보유.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-FNBP1 Antibody
Target: formin binding protein 1 (FNBP1)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human FNBP1.
Alternative Gene Names
FBP17, KIAA0554
Antigen Information
- Target Protein: formin binding protein 1
- Target Gene: FNBP1
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
DYTQPMKRTVSDNSLSNSRGEGKPDLKFGGKSKGKLWPFIKKNKLSLKLGATPEDFSNLPPEQ
Species Reactivity
| Species | Reactivity | Sequence Identity |
|---|---|---|
| Human | Verified | - |
| Rat | Ortholog ENSRNOG00000008258 | 89% |
| Mouse | Ortholog ENSMUSG00000075415 | 87% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-FNBP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FNBP1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FNBP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FN3KRP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-FN3KRP Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|