CacheBy
Atlas Antibodies Anti-FN3KRP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FN3KRP Antibody

상품 한눈에 보기

Human FN3KRP 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. FLJ12171, FN3KL 유전자 대체명으로도 알려져 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056172-100 Anti-FN3KRP Antibody, fructosamine 3 kinase related protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056172-25 Anti-FN3KRP Antibody, fructosamine 3 kinase related protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FN3KRP Antibody

Anti-FN3KRP Antibody

Target: Fructosamine 3 kinase related protein (FN3KRP)
Type: Polyclonal Antibody against Human FN3KRP


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human FN3KRP (fructosamine 3 kinase related protein).


Alternative Gene Names

  • FLJ12171
  • FN3KL

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Fructosamine 3 kinase related protein
Target Gene FN3KRP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFVARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMD
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000036660 (83%), Mouse ENSMUSG00000039253 (80%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 설명
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.