Thermo Fisher Scientific Calpastatin Polyclonal Antibody
인간 Calpastatin을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC/IF, Flow cytometry 등 다양한 응용 가능. 항원 친화 크로마토그래피로 정제된 고품질 항체로, 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific Calpastatin Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human Calpastatin (275–310aa: QEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746041 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Calpastatin is an endogenous inhibitor of calpain, a calcium-dependent cysteine protease. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (1–4). Calpastatin is involved in amyloid precursor protein proteolysis and various membrane fusion events such as neural vesicle exocytosis and platelet aggregation. It may also influence expression levels of genes encoding structural or regulatory proteins.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific CCL20 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HP1 gamma Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Calpastatin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Caveolin 2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Caveolin 2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|