Thermo Fisher Scientific CRY2 Polyclonal Antibody
CRY2 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot과 IHC(P)에서 사용 가능. 인간, 마우스, 랫트 시료에 반응. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 생체시계 관련 연구에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human CRY2 (171–200aa RFQAIISRMELPKKPVGLVTSQQMESCRAE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746189 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Circadian rhythms in biochemical, physiological, and behavioral processes are regulated by an internal biological clock. Cryptochrome proteins (CRY1 and CRY2) are DNA-binding flavoproteins homologous to blue-light receptors and photolyases.
In Drosophila, CRY acts as a photoreceptor for the circadian clock, binding to TIM in a light-dependent manner. Mammalian CRY1 and CRY2 interact with CLOCK, BMAL1, PER1, PER2, and TIM to regulate circadian gene expression in a light-independent manner.
Mutant mice lacking Cry1 or Cry2 show altered locomotor activity rhythms, and double mutants exhibit arrhythmicity, highlighting the essential role of both proteins in maintaining internal circadian timing.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific CSK Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Alpha A Crystallin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CRY2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TORC2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CRK Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|