Thermo Fisher Scientific CRY2 Polyclonal Antibody
CRY2 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot과 IHC(P)에서 사용 가능. 인간, 마우스, 랫트 시료에 반응. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 생체시계 관련 연구에 적합.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific CRY2 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human CRY2 (171–200aa RFQAIISRMELPKKPVGLVTSQQMESCRAE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746189 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Circadian rhythms in biochemical, physiological, and behavioral processes are regulated by an internal biological clock. Cryptochrome proteins (CRY1 and CRY2) are DNA-binding flavoproteins homologous to blue-light receptors and photolyases.
In Drosophila, CRY acts as a photoreceptor for the circadian clock, binding to TIM in a light-dependent manner. Mammalian CRY1 and CRY2 interact with CLOCK, BMAL1, PER1, PER2, and TIM to regulate circadian gene expression in a light-independent manner.
Mutant mice lacking Cry1 or Cry2 show altered locomotor activity rhythms, and double mutants exhibit arrhythmicity, highlighting the essential role of both proteins in maintaining internal circadian timing.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.