
Atlas Antibodies Anti-TMEM61 Antibody
상품 한눈에 보기
Human TMEM61 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 및 WB(재조합 발현 검증)에 적합. PrEST 항원을 이용한 친화 정제. 인간 반응성 검증 완료, 신뢰성 높은 연구용 시약.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TMEM61 Antibody
Target: Transmembrane protein 61 (TMEM61)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody against human TMEM61, validated for recombinant expression and human reactivity.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PRWDPYHLSRDLYYLTVESSEKESCRTPKVVDIPTYEEAVSFPVAEGPPTPPAYPTEEALEPSGSRDALLSTQPAWPPPSYESISLALDAVSAETTPSATRSCSGLVQTARG
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000026594 | 44% |
| Mouse | ENSMUSG00000048029 | 27% |
Buffer Composition
| Component | Concentration / Description |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Sodium Azide | 0.02%, preservative (Material Safety Data Sheet) |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TMEM63B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM63A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM61 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM63A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM52B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.