
Atlas Antibodies Anti-TMEM52B Antibody
Human TMEM52B 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 정제된 PrEST 항원으로 검증됨. Rabbit IgG 형식이며, Orthogonal 및 Recombinant Expression 검증 완료. 인간 반응성 및 높은 종간 서열 유사도 보유.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TMEM52B Antibody
Transmembrane protein 52B
Recommended Applications
IHC (Orthogonal Validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human TMEM52B
Alternative Gene Names
C12orf59, FLJ31166
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transmembrane protein 52B |
| Target Gene | TMEM52B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000058653 (77%), Mouse ENSMUSG00000030160 (75%) |
Antigen Sequence:
QLPSSLDTLPGYEEALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKESTRIVDSWN
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TMEM61 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM63A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM52B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM59L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM62 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|