CacheBy
Atlas Antibodies Anti-TMEM52B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM52B Antibody

상품 한눈에 보기

Human TMEM52B 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 정제된 PrEST 항원으로 검증됨. Rabbit IgG 형식이며, Orthogonal 및 Recombinant Expression 검증 완료. 인간 반응성 및 높은 종간 서열 유사도 보유.

카탈로그번호
HPA058096-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058096-100 Anti-TMEM52B Antibody, transmembrane protein 52B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058096-25 Anti-TMEM52B Antibody, transmembrane protein 52B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM52B Antibody

Anti-TMEM52B Antibody

Transmembrane protein 52B

  • IHC (Orthogonal Validation)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB (Recombinant Expression Validation)
    Recombinant expression validation in WB using target protein overexpression.

  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human TMEM52B

Alternative Gene Names

C12orf59, FLJ31166

Open Datasheet

Target Information

항목 내용
Target Protein transmembrane protein 52B
Target Gene TMEM52B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000058653 (77%), Mouse ENSMUSG00000030160 (75%)

Antigen Sequence:
QLPSSLDTLPGYEEALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKESTRIVDSWN

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.