
Atlas Antibodies Anti-TMEM155 Antibody
상품 한눈에 보기
Human TMEM155 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 고순도와 특이성을 제공. 40% glycerol 기반 PBS 버퍼에 보존제로 sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TMEM155 Antibody
Target Information
- Target Protein: Transmembrane protein 155
- Target Gene: TMEM155
- Alternative Gene Names: FLJ30834
Product Description
Polyclonal antibody against human TMEM155, generated in rabbit.
Recommended for use in immunohistochemistry (IHC) and related applications.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
AVDAELMPSGAILQNKRENLPRVCHALAFLGMARCQDLFLVRLQGWKLGTR
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000078486): 30%
- Rat (ENSRNOG00000023187): 27%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet
Open Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TMEM145 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM154 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM155 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM151B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM150A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.