
Atlas Antibodies Anti-TMEM151B Antibody
상품 한눈에 보기
인간 TMEM151B 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 등 다양한 연구 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응 특이성을 보입니다. 안정적인 PBS/glycerol 버퍼에 보존되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TMEM151B Antibody
Target Information
- Target Protein: Transmembrane protein 151B
- Target Gene: TMEM151B
- Alternative Gene Names: bA444E17.5, C6orf137, TMEM193
Recommended Applications
면역조직화학(IHC)
Product Description
Polyclonal antibody against human TMEM151B.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
CWHCQARHELQHRVDVSSVRERVGRMQQATPCIWWKAISYH
Verified Species Reactivity
Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000096847 | 98% |
| Rat | ENSRNOG00000019958 | 95% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TMEM154 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM155 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM151B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM150A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM14A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.