
Atlas Antibodies Anti-TMEM139 Antibody
상품 한눈에 보기
인간 TMEM139 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. 재조합 단백질 기반으로 검증되었으며, 토끼 유래 IgG 형태입니다. 친화도 정제 방식으로 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TMEM139 Antibody
Target: Transmembrane protein 139 (TMEM139)
Type: Polyclonal antibody against Human TMEM139
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody generated in rabbit against human TMEM139.
Validated for recombinant expression in WB and suitable for IHC applications.
Alternative Gene Names
- FLJ90586
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GSRRAKLEQRRMASEGSMAQEGSPGRAPINLRLRGPRAVSTAPDLQSLAAVPTLEPLTPP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000028024 | 58% |
| Mouse | ENSMUSG00000071506 | 53% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Notes | Gently mix before use. Determine optimal concentration and conditions experimentally. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TMEM150C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM143 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM139 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM141 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM139 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.