CacheBy
Atlas Antibodies Anti-TMEM139 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM139 Antibody

상품 한눈에 보기

인간 TMEM139 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. 재조합 단백질 기반으로 검증되었으며, 토끼 유래 IgG 형태입니다. 친화도 정제 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA036983-100 Anti-TMEM139 Antibody, transmembrane protein 139 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036983-25 Anti-TMEM139 Antibody, transmembrane protein 139 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM139 Antibody

Anti-TMEM139 Antibody

Target: Transmembrane protein 139 (TMEM139)
Type: Polyclonal antibody against Human TMEM139
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody generated in rabbit against human TMEM139.
Validated for recombinant expression in WB and suitable for IHC applications.


Alternative Gene Names

  • FLJ90586

Open Datasheet (PDF)


Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    GSRRAKLEQRRMASEGSMAQEGSPGRAPINLRLRGPRAVSTAPDLQSLAAVPTLEPLTPP

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000028024 58%
Mouse ENSMUSG00000071506 53%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Determine optimal concentration and conditions experimentally.

Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.