
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TMEM139 Antibody
상품 한눈에 보기
인간 TMEM139 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. 재조합 단백질 기반으로 검증되었으며, 토끼 유래 IgG 형태입니다. 친화도 정제 방식으로 높은 특이성과 재현성을 제공합니다.
- 카탈로그번호
- HPA036983-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036983-100 Anti-TMEM139 Antibody, transmembrane protein 139 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036983-25 Anti-TMEM139 Antibody, transmembrane protein 139 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TMEM139 Antibody
Anti-TMEM139 Antibody
Target: Transmembrane protein 139 (TMEM139)
Type: Polyclonal antibody against Human TMEM139
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody generated in rabbit against human TMEM139.
Validated for recombinant expression in WB and suitable for IHC applications.
Alternative Gene Names
- FLJ90586
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GSRRAKLEQRRMASEGSMAQEGSPGRAPINLRLRGPRAVSTAPDLQSLAAVPTLEPLTPP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000028024 | 58% |
| Mouse | ENSMUSG00000071506 | 53% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Notes | Gently mix before use. Determine optimal concentration and conditions experimentally. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



