CacheBy
Atlas Antibodies Anti-TMEM139 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM139 Antibody

상품 한눈에 보기

Human TMEM139을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 WB(재조합 발현 검증)에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 PBS 버퍼에 보존됩니다. 인간 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA036982-100 Anti-TMEM139 Antibody, transmembrane protein 139 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036982-25 Anti-TMEM139 Antibody, transmembrane protein 139 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM139 Antibody

Anti-TMEM139 Antibody

Target: Transmembrane protein 139 (TMEM139)
Type: Polyclonal Antibody against Human TMEM139


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression Validation)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody raised in rabbit against human TMEM139.


Alternative Gene Names

  • FLJ90586

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Transmembrane protein 139
Target Gene TMEM139
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GSRRAKLEQRRMASEGSMAQEGSPGRAPINLRLRGPRAVSTAPDLQSLAAVPTLEPLTPP

Verified Species Reactivity

  • Human

Interspecies Information

종 유전자 ID 항원 서열 일치율
Rat ENSRNOG00000028024 58%
Mouse ENSMUSG00000071506 53%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.