
Atlas Antibodies Anti-TMEM132A Antibody
Human TMEM132A 단백질을 인식하는 토끼 폴리클로날 항체. IHC를 포함한 단백질 발현 분석에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증됨. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성 제공.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TMEM132A Antibody
Target: transmembrane protein 132A
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human TMEM132A
Alternative Gene Names
FLJ20539, GBP, HSPA5BP1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transmembrane protein 132A |
| Target Gene | TMEM132A |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000024736 (92%), Rat ENSRNOG00000021338 (90%) |
Antigen Information
Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
QPVMGISLTLSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEPGAILPAEEQGAQLGVVVSGAGAEGLPLHVAL
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TMEM132E Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM132C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM132A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM132B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM132B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|