CacheBy
Atlas Antibodies Anti-TMEM132B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM132B Antibody

상품 한눈에 보기

Human TMEM132B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에 반응하며 Rat, Mouse와 높은 서열 유사성을 가짐.

카탈로그번호
HPA035661-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035661-100 Anti-TMEM132B Antibody, transmembrane protein 132B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035661-25 Anti-TMEM132B Antibody, transmembrane protein 132B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM132B Antibody

Anti-TMEM132B Antibody

Target Information

  • Target Protein: transmembrane protein 132B
  • Target Gene: TMEM132B
  • Alternative Gene Names: KIAA1786, KIAA1906

Product Description

Polyclonal antibody against Human TMEM132B produced in rabbit. This antibody is affinity purified using the PrEST antigen as an affinity ligand.

Immunohistochemistry (IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VSLTSSSVADQFTLRIKAAAGVKITAVRVSSEDQWAVQEEIDNGSTQTSATLTCMGHRPDTQSRVNGSFYEILQVDFGID

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat: ENSRNOG00000038406 (81%)
  • Mouse: ENSMUSG00000070498 (81%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen
Preservative Sodium azide (0.02%)
Storage Gently mix before use. Store according to manufacturer’s recommendations.

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet
Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.