
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TJP1 Antibody
상품 한눈에 보기
Human TJP1(tight junction protein 1)을 인식하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Recombinant Expression Validation을 통해 검증된 신뢰성 높은 항체. Affinity purification으로 높은 특이성과 순도 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA001636-100 Anti-TJP1 Antibody, tight junction protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001636-25 Anti-TJP1 Antibody, tight junction protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TJP1 Antibody
Anti-TJP1 Antibody
Target Information
- Target Protein: Tight junction protein 1
- Target Gene: TJP1
- Alternative Gene Names: DKFZp686M05161, MGC133289, ZO-1
Product Description
Polyclonal Antibody against Human TJP1
Recommended Applications
- IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Recombinant Expression Validation): Recombinant expression validation in WB using target protein overexpression.
- ICC: Suitable for immunocytochemistry applications.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000011077 | 100% |
| Mouse | ENSMUSG00000030516 | 100% |
Antibody Characteristics
| Parameter | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



