CacheBy
Atlas Antibodies Anti-TJP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TJP2 Antibody

상품 한눈에 보기

Human TJP2(tight junction protein 2)을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 사용 가능. PrEST 항원으로 친화 정제되었으며, RNA-seq 데이터 기반 Orthogonal 검증 완료. Human에 반응하며, 40% glycerol/PBS buffer에 보존됨.

카탈로그번호
HPA070714-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070714-100 Anti-TJP2 Antibody, tight junction protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070714-25 Anti-TJP2 Antibody, tight junction protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TJP2 Antibody

Anti-TJP2 Antibody

Target: tight junction protein 2 (TJP2)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot) — Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human TJP2


Alternative Gene Names

DFNA51, X104, ZO-2, ZO2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein tight junction protein 2
Target Gene TJP2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG

Species Reactivity

항목 내용
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000024812 (92%), Rat ENSRNOG00000015030 (91%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.