
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TIMM10B Antibody
상품 한눈에 보기
Human TIMM10B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 연구용 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인체 반응성이 검증되었습니다. FXC1, TIM10B, Tim9b 유전자와 관련된 연구에 활용 가능합니다.
- 카탈로그번호
- HPA052265-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA052265-100 Anti-TIMM10B Antibody, translocase of inner mitochondrial membrane 10 homolog B (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052265-25 Anti-TIMM10B Antibody, translocase of inner mitochondrial membrane 10 homolog B (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TIMM10B Antibody
Anti-TIMM10B Antibody
Target: translocase of inner mitochondrial membrane 10 homolog B (yeast)
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against Human TIMM10B.
Alternative Gene Names
FXC1, TIM10B, Tim9b
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | translocase of inner mitochondrial membrane 10 homolog B (yeast) |
| Target Gene | TIMM10B |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | QQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000050846 (95%)
- Mouse ENSMUSG00000110234 (93%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 환경에 맞게 조정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



