
Atlas Antibodies Anti-TIMM10B Antibody
상품 한눈에 보기
Human TIMM10B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 연구용 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인체 반응성이 검증되었습니다. FXC1, TIM10B, Tim9b 유전자와 관련된 연구에 활용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TIMM10B Antibody
Target: translocase of inner mitochondrial membrane 10 homolog B (yeast)
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against Human TIMM10B.
Alternative Gene Names
FXC1, TIM10B, Tim9b
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | translocase of inner mitochondrial membrane 10 homolog B (yeast) |
| Target Gene | TIMM10B |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | QQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000050846 (95%)
- Mouse ENSMUSG00000110234 (93%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 환경에 맞게 조정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TIMM21 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TIMELESS Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TIMM10B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TIMM13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TIMD4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.