Thermo Fisher Scientific ZNF416 Polyclonal Antibody
Rabbit polyclonal antibody recognizing ZNF416 protein. Validated for Western blot and ELISA applications. Suitable for mouse samples. Supplied in liquid form with PBS and glycerol buffer. For research use only.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| ELISA | 1 µg/mL |
Product Specifications
| Specification | Detail |
|---|---|
| Species Reactivity | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 495–594 of human ZNF416 (NP_060349.1) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1.4 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.01% thimerosal |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2805786 |
Product Specific Information
- Immunogen sequence: ECSECGKFFRQSYTLVEHQKIHTGLRPYDCGQCGKSFIQKSSLIQHQVVHTGERPYECGKCGKSFTQHSGLILHRKSHTVERPRDSSKCGKPYSPRSNIV
- Positive Samples: Mouse kidney
- Cellular Location: Nucleus
Target Information
May be involved in transcriptional regulation.
⚠ WARNING: This product can expose you to chemicals including mercury, which is known to the State of California to cause birth defects or other reproductive harm.
For more information, visit www.P65Warnings.ca.gov.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific REXO4 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific G2E3 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific ZNF416 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific MRPL2 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific Carbonic Anhydrase II Polyclonal Antibody
618,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|