
원본
Thermo Fisher Scientific ZNF416 Polyclonal Antibody
상품 한눈에 보기
Rabbit polyclonal antibody recognizing ZNF416 protein. Validated for Western blot and ELISA applications. Suitable for mouse samples. Supplied in liquid form with PBS and glycerol buffer. For research use only.
- 카탈로그번호
- PA589809
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 22. 오전 11:36
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA589809 ZNF416 Polyclonal Antibody 100 ul pk판매 단위 pk
재고 1개
618,800원VAT 포함 680,680원
Thermo Fisher Scientific · Thermo Fisher Scientific ZNF416 Polyclonal Antibody
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| ELISA | 1 µg/mL |
Product Specifications
| Specification | Detail |
|---|---|
| Species Reactivity | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 495–594 of human ZNF416 (NP_060349.1) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1.4 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.01% thimerosal |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2805786 |
Product Specific Information
- Immunogen sequence: ECSECGKFFRQSYTLVEHQKIHTGLRPYDCGQCGKSFIQKSSLIQHQVVHTGERPYECGKCGKSFTQHSGLILHRKSHTVERPRDSSKCGKPYSPRSNIV
- Positive Samples: Mouse kidney
- Cellular Location: Nucleus
Target Information
May be involved in transcriptional regulation.
⚠ WARNING: This product can expose you to chemicals including mercury, which is known to the State of California to cause birth defects or other reproductive harm.
For more information, visit www.P65Warnings.ca.gov.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
