Takara Antibodies and ELISA kits

We offer a wide range of primary antibodies and ELISA kits. Choose your research area to be taken to the tools that match your focus.

Cat. #ProductSizeLicenseQuantityDetailsMK150Acrolein-Lysine Adduct Competitive EIA Kit96 Well*

The Acrolein-Lysine Adduct Competitive EIA Kit can be used for measurement of acrolein-protein adducts in blood, urine, or tissue samples. The kit is a competitive EIA that uses a monoclonal antibody that reacts specifically with the formyl-dehydropiperidino (FDP)-lysine (Lys) structures that are created when acrolein binds to the lysine residues of proteins. Quantitative measurement of acrolein adducts in a sample is calculated using the quantity of FDP-Lys.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK150: Acrolein-Lysine Adduct Competitive EIA Kit

MA309BAnti-Acetyl Histone H3 (Lys27), mouse monoclonal antibody100 uL*

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

MA305BAnti-Acetyl Histone H3 (Lys9), mouse monoclonal antibody100 uL*

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

MA310BAnti-Acetyl Histone H3 (Lys9/27), mouse monoclonal antibody100 uL*

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

MA332BAnti-Dimethyl Histone H3 (Lys36), Mouse Monoclonal Antibody100 uL*

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

MA303BAnti-dimethyl Histone H3 (Lys4), mouse monoclonal antibody100 uL*

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

MA307BAnti-Dimethyl Histone H3 (Lys9), mouse monoclonal antibody100 uL*

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

MA301BAnti-Histone H3 (mouse), Monoclonal100 uL*

An anti-histone antibody for the study of histone modifications related to epigenetic analysis. This antibody can be used for chromatin immunoprecipitation (ChIP) assays. Histone H3 antibodies were generated via a 13-amino acid peptide on N-terminal human histone H3.1.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

M231Anti-Human Crx, Polyclonal0.2 mg*

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a rabbit polyclonal antibody raised against two peptide fragments of Human Crx (Cone-rod homeobox protein; a transcription factor that is specifically expressed in photoreceptors and pinealocytes and is important for development and functional homeostasis of cone cells and rod cells forming the retinal cells) conjugated with KLH.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Alignment of peptide sequences from several Crx homologs

Alignment of peptide sequences from several Crx homologs.

M232Anti-Human Insulin C, Monoclonal (Clone h-Ins 1B-1)0.1 mg*

Monoclonal antibody was obtained by fusing the mouse myeloma cell line P3U1 with spleen cells of C57BL/6 mouse after immunization with KLH-conjugated peptide from human insulin C-peptide sequence (71–86) [GPGAGSLQPLALEGSL]. The monoclonal antibody was harvested from ascitic fluid of a SCID mouse.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components

M227Anti-Human/Mouse Bf1, Polyclonal0.2 mg*

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a rabbit polyclonal antibody raised against C-terminal region peptide of human/mouse Brain factor 1 (Transcription Factor BF-1/forkhead box protein G1/FOXG1B) [SLPSF TTGLS GGLSD YFTHQ NQGSS SNPLI H] conjugated with bovine thyroglobulin. Brain factor 1 is a transcription factor that is localized in the neural progenitor cells for the cerebrum. It is responsible for the development of the telencephalon.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Alignment of the C-terminal amino acid sequences of several Bf1 homologs

Alignment of the C-terminal amino acid sequences of several Bf1 homologs.

Back

Immunohistochemical Staining with Anti-Human/Mouse Bf1, Polyclonal (Cat

Immunohistochemical Staining with Anti-Human/Mouse Bf1, Polyclonal (Cat. No. M227) and DAPI. Tissue: Embryonic mouse, day 11 (E11). Fixation: 4% paraformaldehyde. Permeabilization: 0.3% Triton X-100 in PBS. Blue, DAPI stain; red, anti-Bf1 antibody.

M229Anti-Human/Mouse Rx, Polyclonal (Guinea Pig)0.2 mg*

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a guinea pig polyclonal antibody raised against three peptide fragments of Rx (Retinal homeobox protein; a homeobox transcription factor that functions in eye development and is expressed early in the eye primordi,) conjugated with KLH.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Alignment of peptide sequences from several Rx homologs

Alignment of peptide sequences from several Rx homologs.

Back

Immunohistochemical Staining with Anti-Human/Mouse Rx, Polyclonal (Guinea Pig) (Cat

Immunohistochemical Staining with Anti-Human/Mouse Rx, Polyclonal (Guinea Pig) (Cat. No. M229) and DAPI. Tissue: Mouse head, sagittal section. Fixation: 4% paraformaldehyde. Permeabilization: 0.3% Triton X-100 in PBS. Blue, DAPI stain; red, anti-Rx antibody.

MA321BAnti-Monomethyl Histone H3 (Lys27), Mouse Monoclonal Antibody100 uL*

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

MA331BAnti-Monomethyl Histone H3 (Lys36), Mouse Monoclonal Antibody100 uL*

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

MA302BAnti-Monomethyl Histone H3 (Lys4), mouse monoclonal antibody100 uL*

An anti-histone antibody for the study of histone modifications related to epigenetic analysis. This antibody can be used for chromatin immunoprecipitation (ChIP) assays. Histone H3 antibodies were generated via a 13-amino acid peptide on N-terminal human histone H3.1.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

MA306BAnti-Monomethyl Histone H3 (Lys9), mouse monoclonal antibody100 uL*

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

M234Anti-Mouse Albumin, Monoclonal (Clone M-Alb 151-1)0.1 mg*

Antibody for detection of albumin: Monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with lymph cells from an SD rat after immunization with purified albumin from mouse plasma. The monoclonal antibody was harvested from the clone`s culture supernatant in serum free medium.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M234: Anti-Mouse Albumin, Monoclonal (Clone M-Alb 151-1)

M233Anti-Mouse Insulin C, Monoclonal (Clone M-Ins 1J-4)0.1 mg*

Monoclonal antibody was obtained by fusing the mouse myeloma cell line P3U1 with spleen cells of SD rat after immunization with KLH-conjugated peptide from mouse insulin C-peptide sequence (71–84) [SPGDLQTLALEVAR]. The monoclonal antibody was harvested from ascitic fluid of a SCID mouse.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M233: Anti-Mouse Insulin C, Monoclonal (Clone M-Ins 1J-4)

M178Anti-Mouse Insulin C, Polyclonal0.1 mg*

This antibody is suitable for studies on the structure, function, and metabolism of insulin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Amino acid alignment of insulin from various mammals

Amino acid alignment of insulin from various mammals. The C-peptide region is boxed (amino acides 57-88), and the peptide used to produce this antibody (Cat. # M178) is highlighted in blue.

M230Anti-Mouse Irx3, Polyclonal0.2 mg*

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a rabbit polyclonal antibody raised against C-terminal region peptide of mouse Irx3 (Iroquois related homeobox 3) [CSALE VEKKL LKTAF QPVPR RPQNH LDAAL VLSAL SSS] conjugated with KLH. Irx 3 is a transcription factor that is localized in the caudal nerve and expressed in the neural plate during the early development of the central nervous system.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Alignment of the C-terminal amino acid sequences of several Irx3 homologs

Alignment of the C-terminal amino acid sequences of several Irx3 homologs.

Back

Immunohistochemical Staining with Anti-Mouse Irx3, Polyclonal (Cat

Immunohistochemical Staining with Anti-Mouse Irx3, Polyclonal (Cat. No. M230) and DAPI. Tissue: Embryonic mouse, day 10 (E10). Fixation: 4% paraformaldehyde, 6 h. Permeabilization: 0.3% Triton X-100 in PBS. Blocking: 10% normal Donkey serum in PBS. Blue, DAPI stain; red, anti-Irx3 antibody.

M228Anti-Mouse Rx, Polyclonal0.2 mg*

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a rabbit polyclonal antibody raised against three peptide fragments of Rx (Retinal homeobox protein; a homeobox transcription factor that functions in eye development and is expressed early in the eye primordi,) conjugated with KLH.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Immunohistochemical Staining with Anti-Mouse Rx, Polyclonal (Cat

Immunohistochemical Staining with Anti-Mouse Rx, Polyclonal (Cat. No. M228) and DAPI. Tissue: Mouse head, sagittal section. Fixation: 4% paraformaldehyde. Permeabilization: 0.3% Triton X-100 in PBS. Blue, DAPI stain; red, anti-Rx antibody.

Back

Alignment of peptide sequences from several Rx homologs

Alignment of peptide sequences from several Rx homologs.

MA251BAnti-Phospho Histone H2B (Ser14), Mouse Monoclonal Antibody100 uL*

An anti-histone antibody for the study of histone modifications related to epigenetic analysis. This antibody can be used for chromatin immunoprecipitation (ChIP) assays. The Anti-Phospho Histone H2B (Ser14) antibody (MA251B) was generated via a 19-amino acid peptide surrounding Ser14 on human histone H2B.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

MA312BAnti-Phospho Histone H3 (Ser10), mouse monoclonal antibody100 uL*

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

M235Anti-Rat Albumin, Monoclonal (Clone R-Alb 214A-1)0.1 mg*

Antibody for detection of albumin: Monoclonal antibody was obtained by fusing the mouse myeloma cell line P3U1 with spleen cells from a C57BL/6 mouse after immunization with purified albumin from rat plasma. The monoclonal antibody was harvested from ascitic fluid of a SCID mouse.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M235: Anti-Rat Albumin, Monoclonal (Clone R-Alb 214A-1)

MA323BAnti-Trimethyl Histone H3 (Lys27), Mouse Monoclonal Antibody100 uL*

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

MA333BAnti-Trimethyl Histone H3 (Lys36), Mouse Monoclonal Antibody100 uL*

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

MA304BAnti-Trimethyl Histone H3 (Lys4), mouse monoclonal antibody100 uL*

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

MA308BAnti-Trimethyl Histone H3 (Lys9), mouse monoclonal antibody100 uL*

Anti-histone antibodies for the study of histone modifications related to epigenetic analysis. These antibodies may be used for chromatin immunoprecipitation (ChIP) assays.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

M190Bone Specific Alkaline Phosphatase (Rat), Polyclonal0.1 mg*

This product was raised against conjugate of KLH and the peptide (20–49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN] that illustrates an exceptional homology with human and rat Bone Specific Alkaline Phosphatase.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components

Y20010Cellartis® hES-Cellect™150 ug*

Monoclonal antibody derived from hybridoma cells produced by the fusion of mouse myeloma cells and spleen cells from BALB/C mice immunized with purified whole undifferentiated human embryonic stem (hES) cells.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents

M193Collagen type 2 Clone 20G-12E (Rat), Monoclonal0.1 mg*

Monoclonal antibody was produced from an established hybridoma obtained by fusing the mouse myeloma cell line P3U1 with lympho cells from a C57BL/6 mouse after immunization with rat collagen type II. The monoclonal antibody was harvested from ascitic fluid of a SCID mouse.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components

MK115Fibronectin EIA Kit96 Assays*

The human Fibronectin EIA Kit is an in vitro enzyme immunoassay (EIA) kit for the specific quantitative determination of human fibronectin in serum, urine, cell culture supernatants, and other biological fluids. This kit is suitable for quantitation of soluble human fibronectin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Application Example: Fibronectin Levels in Cell Culture Supernatants The amount of Fibronectin in the supernatant of various cells cultured in 10% FCS/RPMI 1640 or serum free/Ultradoma PF was measured

*Application Example: Fibronectin Levels in Cell Culture Supernatants
*

The amount of Fibronectin in the supernatant of various cells cultured in 10% FCS/RPMI 1640 or serum free/Ultradoma PF was measured. The supernatant was applied to the assay without dilution. Fetal calf serum does not inhibit this assay system.

+S: 10% FCS/RPMI 1640
SF: serum free medium (2 days after the change from the medium containing serum)

.

Back

MK115: Fibronectin EIA Kit

MK147Gla/Glu Osteocalcin High Sensitive EIA Set (Rat)Each*

Gla/Glu Osteocalcin High Sensitive EIA Set (Rat; Cat. # MK147) is a combination of Rat Gla-Osteocalcin High Sensitive EIA Kit (Cat.# MK126) and Rat Glu-Osteocalcin High Sensitive EIA Kit (Cat.# MK146). Since both kits have the same capture antibody, they can be used together for simultaneous Gla/Glu detection, thereby making simultaneous monitoring of bone formation and resorption possible.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Image Data

Back

MK147: Gla/Glu Osteocalcin High Sensitive EIA Set (Rat)

MK111Gla-Type Osteocalcin (Gla-OC) EIA Kit96 Assays*

The Gla-type Osteocalcin EIA Kit is an in vitro enzyme immunoassay (EIA) kit for quantitative determination of human Gla-OC in serum, cultured cell extracts, cell culture supernatants, and other biological fluids.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

MK111: Gla-Type Osteocalcin (Gla-OC) EIA Kit

MK132Human Albumin EIA Kit96 Rxns*

This quantification kit using a human albumin-specific monoclonal antibody can be utilized as a simple tool to monitor albumin levels in human serum and body fluids, among other purposes.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components

MK128Human Gla-Osteocalcin High Sensitive EIA Kit96 Rxns*

This kit is designed to precisely differentiate bovine and human osteocalcins, using a capture antibody-coated plate with a human osteocalcin-specific monoclonal antibody that recognizes the distinct difference in the amino acids at positions 3 and 4 from the N-terminus. This makes possible differential assays of human and bovine osteocalcins. Use of human antigen-specific antibody as a capture monoclonal antibody provides improved linearity when assaying human blood samples. This specificity also enables direct assay of human osteocalcin in the culture supernatant of osteoblasts or differentiated osteoblasts from bone marrow or mesenchymal stem cells cultured in a bovine serum-containing medium, which has been difficult to achieve using the conventional Gla-OC EIA Kit (Cat. #MK111).

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

MK128: Human Gla-Osteocalcin High Sensitive EIA Kit

MK103Human Vitronectin EIA Kit96-Well*

The Human Vitronectin EIA Kit can detect two types of VN protein (65 and 75 kD) in blood using monoclonal antibodies. It can be also used for VN detection in urine and cell culture supernatant. In addition, this kit can also detect vitronectin in rabbit. Because the antibody in this kit does not cross-react with bovine vitronectin antigens, cell culture medium containing fetal bovine serum can be measured directly.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK103: Human Vitronectin EIA Kit

MK114Human/Pig Osteonectin EIA Kit96-Well*

This kit is a sandwich-type osteonectin EIA assay based on two monoclonal antibodies, which are derived from bovine and human osteonectin antigens. It enables simple quantification of human, pig, bovine, and rabbit osteonectin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK114: Human/Pig Osteonectin EIA Kit

MK107Laminin EIA Kit96 Rxns*

The Laminin EIA Kit is an in vitro enzyme immunoassay (EIA) kit for quantitative determination of human LN in plasma, serum, urine, cultured cell extracts, cell culture supernatants, and other biological fluids.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

MK107: Laminin EIA Kit

M222Lin28 (Human), Monoclonal0.1 mg*

This monoclonal antibody was raised by fusing the P3Ul mouse myeloma cell line with lymph node cells of C57B46 mouse with human Lin28 recombinant protein. The antibody specifically recognizes human Lin28.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components

M226Monoclonal Antibody to Human Albumin0.1 mg*

Antibody for detection of albumin: Monoclonal antibody was obtained by fusing the mouse myeloma cell line P3U1 with spleen cells from a BALB/c mouse after immunization with purified human albumin from human plasma.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M226: Anti-Human Albumin, Monoclonal (Clone hAlb3-7A)

M225Monoclonal Antibody to Human Alpha Fetoprotein0.1 mg*

Antibody for detection of alpha-fetoprotein (AFP): Monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with spleen cells of BALB/c mouse after immunization with purified human alpha fetoprotein from human plasma.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M225: Anti-Human Alpha Fetoprotein, Monoclonal

M201Monoclonal Antibody to TF (Trigger Factor)0.1 mg*

Monoclonal antibody to Trigger Factor (TF) molecular chaperone; can be used for western blotting or immunoprecipitation of TF-tagged recombinant proteins. This antibody was obtained by fusing the P3U1 myeloma cell line with lymph node cells from a C57BL/6 mouse after immunization with synthetic peptide (165–178)［ TIDFTGSVDGEEFE］ of Trigger Factor (a chaperon protein derived from E. coli) conjugated with KLH. The monoclonal antibody was harvested from ascitic fluid from a SCID mouse.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M201: Monoclonal Antibody to TF (Trigger Factor)

M041Monoclonal Anti-Bovine Osteocalcin (Clone OC4-30)0.1 mg*

This clone was raised against bovine osteocalcin, and equally recognizes both the bovine and the human osteocalcins. Clone OC4-30 is specific for γ-carboxylated osteocalcin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

Recognition Sites of Anti-Osteocalcin Monoclonal Antibodies Assayed by Peptide Fragments

Recognition Sites of Anti-Osteocalcin Monoclonal Antibodies Assayed by Peptide Fragments.

Back

M041: Monoclonal Anti-Bovine Osteocalcin (Clone OC4-30)

M042Monoclonal Anti-Bovine Osteocalcin (Clone OCG2)0.1 mg*

This clone was raised against bovine osteocalcin, and equally recognizes both the bovine and the human osteocalcins.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M042: Anti-Bovine Osteocalcin, Monoclonal (Clone OCG2)

M043Monoclonal Anti-Bovine Osteocalcin (Clone OCG3)0.1 mg*

This clone was raised against bovine osteocalcin, and equally recognizes both the bovine and the human osteocalcins.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M043: Anti-Bovine Osteocalcin, Monoclonal (Clone OCG3)

M044Monoclonal Anti-Bovine Osteocalcin (Clone OCG4)0.1 mg*

This clone was raised against bovine osteocalcin, and equally recognizes both the bovine and the human osteocalcins.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M044: Anti-Bovine Osteocalcin, Monoclonal (Clone OCG4)

M110Monoclonal Anti-chicken N-Cadherin (Clone NCD-2)0.1 mg*

Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. NCD-2 was purified from serum-free culture supernatant.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M110: Monoclonal Anti-chicken N-Cadherin (Clone NCD-2)

M045Monoclonal Anti-Human Calpastatin (Clone CSL1-5)0.1 mg*

This monoclonal anti-human calpastatin antibody (CSL1-5 clone) was raised against recombinant muscle-type calpastatin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

Recognition Sites of the Anti-Human Calpastatin Antibodies

Recognition Sites of the Anti-Human Calpastatin Antibodies.

M106Monoclonal Anti-Human E-cadherin (Clone HECD-1)0.1 mg*

Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. HECD-1 was purified from ascitic fluid.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

The amino-terminal extracellular portion of the molecule contains sequences that determine the specificity of each cadherin

The amino-terminal extracellular portion of the molecule contains sequences that determine the specificity of each cadherin. Calcium is required for cadherin-mediated adhesion and also protects cadherins against proteolysis. Clone ECCD-1, PCD-1, and NCD-2 recognize residues around Glu 16 of murine E-cadherin, Gly(31) of murine P-cadherin, and ser(31) of chick N-cadherin, respectively.

Back

Disruption of tumor cell-cell adhesion by anti-E-cadherin MAbs

Disruption of tumor cell-cell adhesion by anti-E-cadherin MAbs.

.

Back

M106: Monoclonal Anti-Human E-cadherin (Clone HECD-1)

M126Monoclonal Anti-Human E-cadherin (Clone SHE78-7)0.1 mg*

Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. SHE78-7 was purified from ascitic fluid.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M126: Anti-Human E-cadherin, Monoclonal (Clone SHE78-7)

M002Monoclonal Anti-Human Fibronectin (Clone FN12-8)0.4 mg*

These clones were raised against purified human plasma fibronectin. Each recognizes discrete epitopes of fibronectin. For antibody Western blots or histology, clone FN30-8 works best and is also effective for adhesion blockade studies. Clones FN12-8 and FNH3-8 are unique in that they can be used for studies related to fibrin and heparin interactions, respectively.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

Immunohistochemical staining of fibronectin (FN) in human well-differentiated colon cancer tissue (bottom) and moderately-differentiated colon cancer (top)

Immunohistochemical staining of fibronectin (FN) in human well-differentiated colon cancer tissue (bottom) and moderately-differentiated colon cancer (top). Tissues were stained with monoclonal anti-FN antibodies. Antibody used for each panel: left, clone FN8-12 (discontinued); center, clone FN12-8 (Cat. # M002); right, rabbit polyclonal anti-human FN antibody. Strong staining was observed in cancer tissue samples using the monoclonal FN antibodies.

Back

M002: Anti-Human Fibronectin, Monoclonal (Clone FN12-8)

M010Monoclonal Anti-Human Fibronectin (Clone FN30-8)0.4 mg*

These clones were raised against purified human plasma fibronectin. Each recognizes discrete epitopes of fibronectin. For antibody Western blots or histology, clone FN30-8 works best and is also effective for adhesion blockade studies. Clones FN12-8 and FNH3-8 are unique in that they can be used for studies related to fibrin and heparin interactions, respectively.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

Immunohistochemical staining of fibronectin (FN) in human well-differentiated colon cancer tissue (bottom) and moderately-differentiated colon cancer (top)

Immunohistochemical staining of fibronectin (FN) in human well-differentiated colon cancer tissue (bottom) and moderately-differentiated colon cancer (top). Tissues were stained with monoclonal anti-FN antibodies. Antibody used for each panel: left, clone FN8-12 (discontinued); center, clone FN12-8 (Cat. # M002); right, rabbit polyclonal anti-human FN antibody. Strong staining was observed in cancer tissue samples using the monoclonal FN antibodies.

Back

M010: Anti-Human Fibronectin, Monoclonal (Clone FN30-8)

M145Monoclonal Anti-Human Influenza A (H1N1, H2N2) (Clone C179)0.1 mg*

Influenza virus is classified into three groups (A, B, and C). Clinically prevalent types of Influenza virus are H1, H3 and B strain. Influenza virus is further classified into subtypes based on variances in Neuraminidase (NA) and Haemagglutinin (HA) that are the surface glycoprotein of the virus. H1N1 subtype and H3N2 subtype are known to cause severe febrile illness. An influenza virus particle consists of a head region and a stem region. The head region has a receptor domain and the stem region contains a region required for fusion between the virus and the target cell. Takara offers several influenza antibodies that are useful for various viral detection and typing methods, as well as neutralization assays. These antibodies are for research use only.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

Structure of Influenza Virus

Structure of Influenza Virus.

Back

M145: Monoclonal Anti-Human Influenza A (H1N1, H2N2) (Clone C179)

M146Monoclonal Anti-Human Influenza A (H3N2) (Clone F49)0.1 mg*

Influenza virus is classified into three groups (A, B, and C). Clinically prevalent types of Influenza virus are H1, H3 and B strain. Influenza virus is further classified into subtypes based on variances in Neuraminidase (NA) and Haemagglutinin (HA) that are the surface glycoprotein of the virus. H1N1 subtype and H3N2 subtype are known to cause severe febrile illness. An influenza virus particle consists of a head region and a stem region. The head region has a receptor domain and the stem region contains a region required for fusion between the virus and the target cell. Takara offers several influenza antibodies that are useful for various viral detection and typing methods, as well as neutralization assays. These antibodies are for research use only.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M146: Monoclonal Anti-Human Influenza A (H3N2) (Clone F49)

M148Monoclonal Anti-Human Influenza B (Clone 9D6)0.1 mg*

Influenza virus is classified into three groups (A, B, and C). Clinically prevalent types of Influenza virus are H1, H3 and B strain. Influenza virus is further classified into subtypes based on variances in Neuraminidase (NA) and Haemagglutinin (HA) that are the surface glycoprotein of the virus. H1N1 subtype and H3N2 subtype are known to cause severe febrile illness. An influenza virus particle consists of a head region and a stem region. The head region has a receptor domain and the stem region contains a region required for fusion between the virus and the target cell. Takara offers several influenza antibodies that are useful for various viral detection and typing methods, as well as neutralization assays. These antibodies are for research use only.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M148: Monoclonal Anti-Human Influenza B (Clone 9D6)

M020Monoclonal Anti-Human Laminin (Clone LN82-13)0.1 mg*

This antibody is designed to detect laminin using western blotting analysis under non-reducing and non-heating conditions and for histology on frozen tissue sections and paraffin embedded tissue sections.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data Resources

Back

M020: Anti-Human Laminin, Monoclonal (Clone LN82-13)

M184Monoclonal Anti-Human Osteocalcin (Clone 5-12H)0.1 mg*

This monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with spleen cells of C57BL6 mouse after immunization with KLH-conjugated peptide from human osteocalcin sequence (amino acids 1-6 YLYQWL). The monoclonal antibody was harvested from scid mouse ascitic fluid.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

M184: Anti-Human Osteocalcin, Monoclonal (Clone 5-12H)

M127Monoclonal Anti-Human P-cadherin (Clone NCC-CAD-299)0.1 mg*

Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. NCC-CAD-299 was purified from ascitic fluid.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M127: Anti-Human P-cadherin, Monoclonal (Clone NCC-CAD-299)

M063Monoclonal Anti-Human Platelet GMP-140 (P-selectin/CD62) (Clone PL7-6)0.1 mg*

This clone was raised against activated human platelet GMP-140.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents You May Also Like Image Data Resources

Back

M063: Anti-Human Platelet GMP-140 (CD62), Monoclonal (Clone PL7-6)

M062Monoclonal Anti-Human Platelet GMP-140 (P-selectin/CD62) (Clone WGA-1)0.1 mg*

This clone was raised against activated human platelet GMP-140.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents You May Also Like Image Data Resources

Back

M062: Anti-Human Platelet GMP-140 (CD62), Monoclonal (Clone WGA-1)

M011Monoclonal Anti-Human Procollagen Type I C-Peptide (PIP) (Clone PC5-5)0.1 mg*

Collagens (types I, II, III, IV and V) are synthesized as precursor molecules called procollagens. These contain propeptide sequences, at both the amino-terminal and the carboxy-terminal ends. The function of these propeptides is to facilitate the winding of procollagen molecules into a triple-helical conformation within the endoplasmic reticulum. The propeptides are cleaved off from the collagen triple helix molecule during its secretion. The triple helix collagens then polymerize into extracellular collagen fibrils.

Clones PC5-5 and PC8-7 recognize procollagen type I C-peptide. They are suitable for the detection of non-denatured antigen released in tissue culture media and for monitoring of collagen synthesis.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data Resources

Back

M011: Monoclonal Anti-Human Procollagen Type I C-Peptide (PIP) (Clone PC5-5)

M012Monoclonal Anti-Human Procollagen Type I C-Peptide (PIP) (Clone PC8-7)0.1 mg*

Collagens (types I, II, III, IV and V) are synthesized as precursor molecules called procollagens. These contain propeptide sequences, at both the amino-terminal and the carboxy-terminal ends. The function of these propeptides is to facilitate the winding of procollagen molecules into a triple-helical conformation within the endoplasmic reticulum. The propeptides are cleaved off from the collagen triple helix molecule
during its secretion. The triple helix collagens then polymerize into extracellular collagen fibrils.

Clones PC5-5 and PC8-7 recognize procollagen type I C-peptide. They are suitable for the detection of non-denatured antigen released in tissue culture media and for monitoring of collagen synthesis.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

M012: Anti-Human Procollagen Type I C-peptide (PIP), Monoclonal (Clone PC8-7)

M171Monoclonal Anti-Human Undercarboxylated Osteocalcin (Clone GluOC4-5)0.1 mg*

This clone was raised against human osteocalcin peptide. It specifically recognizes human osteocalcin with decarboxylated glutamic acid residues, and does not recognize Gla-type osteocalcin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

M171: Anti-Human Undercarboxylated Osteocalcin, Monoclonal (Clone GluOC4-5)

M017Monoclonal Anti-Human Vitronectin (Clone VN58-1)0.2 mg*

This monoclonal antibody was raised against purified human vitronectin. It may be used for Western blots or histology on frozen sections or paraffin embedded tissue. Clone VN58-1 does not interfere with the cell-binding activity of vitronectin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

M017: Anti-Human Vitronectin, Monoclonal (Clone VN58-1)

M029Monoclonal Anti-Human von Willebrand Factor (vWF) (Clone VW92-3)0.2 mg*

Clone VW92-3 was obtained using a V8 Protease III fragment of human plasma von Willebrand factor as immunogen. This antibody specifically recognizes human von Willebrand factor and does not cross react with bovine von Willebrand factor.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M029: Anti-Human von Willebrand Factor (vWF), Monoclonal (Clone VW92-3)

M147Monoclonal Anti-Influenza A (H1, H2, H3) (Clone C111)0.1 mg*

Influenza virus is classified into three groups (A, B, and C). Clinically prevalent types of Influenza virus are H1, H3 and B strain. Influenza virus is further classified into subtypes based on variances in Neuraminidase (NA) and Haemagglutinin (HA) that are the surface glycoprotein of the virus. H1N1 subtype and H3N2 subtype are known to cause severe febrile illness. An influenza virus particle consists of a head region and a stem region. The head region has a receptor domain and the stem region contains a region required for fusion between the virus and the target cell. Takara offers several influenza antibodies that are useful for various viral detection and typing methods, as well as neutralization assays. These antibodies are for research use only.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M147: Monoclonal Anti-Influenza A (H1, H2, H3) (Clone C111)

M107Monoclonal Anti-mouse E-cadherin (Clone ECCD-1)0.1 mg*

Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. ECCD-1 was purified from serum-free culture supernatant.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M107: Monoclonal Anti-mouse E-cadherin (Clone ECCD-1)

M108Monoclonal Anti-mouse E-cadherin (Clone ECCD-2)0.1 mg*

Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. ECCD-2 was purified from serum-free culture supernatant.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M108: Monoclonal Anti-mouse E-cadherin (Clone ECCD-2)

M188Monoclonal Anti-Mouse Osteocalcin (Clone R21C-01A)0.1 mg*

Monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with spleen cells of SD rat after immunization with KLH-conjugated peptide from mouse osteocalcin sequence (amino acids 25–46 CDELSDQYGLKTAYKRIYGITI). The monoclonal antibody was harvested from ascites fluid of scid mouse.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

M188: Monoclonal Anti-Mouse Osteocalcin (Clone R21C-01A)

M109Monoclonal Anti-mouse P-cadherin (Clone PCD-1 )0.1 mg*

Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. PCD-1 was purified from serum-free culture supernatant.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M109: Monoclonal Anti-mouse P-cadherin (Clone PCD-1 )

M125Monoclonal Anti-Osteonectin/SPARC (Clone ON1-1)0.1 mg*

This clone was raised against bone-derived bovine osteonectin (ON1-1) and human platelet derived osteonectin (OSN4-2). It reacts with thrombin-stimulated platelets, not with non-stimulated platelets.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Immunohistochemical detection of Osteonectin/SPARC in miniature pig tissue

Immunohistochemical detection of Osteonectin/SPARC in miniature pig tissue. A section of paraffin-embedded miniature pig joint tissue was stained with an anti-Osteonectin/SPARC monoclonal antibody (Cat. # M125). Takara POD Conjugate Anti Mouse, For Tissue (Cat. # MK204) was used in place of a traditional secondary antibody, and Takara DAB Substrate (Cat. # MK210) was used for detection. The image shown is 100X magnification.

Back

M125: Anti-Osteonectin/SPARC, Monoclonal (Clone ON1-1)

M124Monoclonal Anti-Osteonectin/SPARC (Clone OSN4-2)0.1 mg*

This clone was raised against bone-derived bovine osteonectin (ON1-1) and human platelet derived osteonectin (OSN4-2). It reacts with thrombin-stimulated platelets, not with non-stimulated platelets.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Resources

M200Monoclonal Anti-Pro S2, (Clone ProS 7B-8F)0.1 mg*

Anti-Protein S is a monoclonal antibody used for detection of ProS2-fused protein expressed by using pCold ProS2 DNA. ProS2 is about 23 kDa of a solubilization tag which is a tandem-dimer of the N-terminal domain of Protein S, a soluble protein derived from myxobacteria Myxococcus xanthus.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

M200: Anti-ProS2, Monoclonal

M192Monoclonal Anti-Rat Collagen type II (Clone Col II 2B-11F)0.1 mg*

Monoclonal antibody was produced from an established hybridoma obtained by fusing the mouse myeloma cell line P3U1 with lympho cells from a C57BL/6 mouse after immunization with rat collagen type II. The monoclonal antibody was harvested from ascitic fluid of a SCID mouse.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components

M186Monoclonal Anti-Rat Osteocalcin (Clone 6-7H)0.1 mg*

This monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with spleen cells from a BALB/c mouse after immunization with a KLH-conjugated peptide from rat osteocalcin (amino acids 1–25: YLNNGLGAPAPYPDPLEPHREVCEL). The monoclonal antibody was harvested from ascitic fluid.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M186: Anti-Rat Osteocalcin, Monoclonal (Clone 6-7H)

M187Monoclonal Anti-Rat Osteocalcin (Clone 9-12H)0.1 mg

License Statement

ID Number
M76	This product is covered by the claims of Japanese Patent No. 5280916.

*

This monoclonal antibody was obtained by fusing the mouse myeloma cell-line P3U1 with spleen cells from a BALB/c mouse after immunization with a KLH-conjuagated peptide from rat osteocalcin (amino acids 38–50: FQDAYKRIYGTTV). The monoclonal antibody was harvested from ascitic fluid.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components

M185Monoclonal Anti-Rat Osteocalcin (Clone D-8G)0.1 mg*

This monoclonal antibody was obtained by fusing the mouse myeloma cell line P3U1 with spleen cells from a BALB/c mouse after immunization with a KLH-conjugated peptide from rat osteocalcin (amino acids 1–25: YLNNGLGAPAPYPDPLEPHREVCEL). The monoclonal antibody was harvested from ascitic fluid.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M185: Anti-Rat Osteocalcin, Monoclonal (Clone D-8G)

MK133Mouse Albumin EIA Kit96-Well*

This product is a sandwich-type mouse albumin assay kit that uses two rat monoclonal antibodies generated against mouse albumin. The kit makes it possible to easily measure mouse albumin in vitro and in vivo. Since the assay is performed using monoclonal antibodies, it provides excellent specificity because these antibodies do not cross-react with albumin from other species.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK133: Mouse Albumin EIA Kit

MK127Mouse Gla-Osteocalcin High Sensitive EIA Kit96 Rxns*

The Mouse Gla-Osteocalcin High Sensitive EIA Kit is an quantitative kit that enables specific and highly sensitive assay of mouse Gla-osteocalcin that exhibits a potential to osseointegration (active osteocalcin). The capture antibody (plate-bound antibody) is a plate-bound solid-phased rat monoclonal antibody that specifically recognizes the C-terminal region of mouse osteocalcin. It is paired with labeled antibody-a monoclonal antibody for detecting osteocalcin with Gla residues. Because mouse osteocalcin has C terminal region sequences that differ from those in humans, cattle and other large animals, it is possible to measure mouse osteocalcin without any cross-reaction with bovine antigens through capture of the antigen with antibodies recognizing a C-terminal epitope. Therefore, one can monitor the process of osteoblastic cell differentiation from pluripotent cells such as mouse ES and iPS cells without interference from bovine serum included in the culture medium.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

MK127: Mouse Gla-Osteocalcin High Sensitive EIA Kit

MK129Mouse Glu-Osteocalcin High Sensitive EIA Kit96 Rxns*

The Mouse Glu-Osteocalcin High Sensitive EIA Kit is an quantitative kit that enables specific and highly sensitive assay of decarboxylated osteocalcin from mouse bone tissue by enzymes present in osteoclasts and Glu-type osteocalcin (inactive osteocalcin) that has been produced by osteoblasts but has not undergone carboxylation. Because mouse osteocalcin has C terminal sequences that differ from those in humans, cattle, and other large animals, it is possible to measure mouse osteocalcin without cross-reaction with bovine antigens by using antibodies that recognize C-terminal epitopes. Therefore, it is possible to monitor osteoblastic cell differentiation from pluripotent cells such as mouse ES and iPS cells without interference from bovine serum included in the culture medium. Bone turnover can also be analyzed by simultaneously measuring Gla-type and Glu-type osteocalcin. Gla-type osteocalcin can be evaluated using the Mouse Gla-Osteocalcin High Sensitive EIA Kit (Cat. #MK127), which includes a monoclonal antibody that specifically recognizes the Gla residues of osteocalcin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data

Back

MK129: Mouse Glu-Osteocalcin High Sensitive EIA Kit

M221Oct4 (Human), Monoclonal0.1 mg*

This monoclonal antibody was raised by fusing the P341 mouse myeloma cell line with lymph node cells of C47B46 mouse with recombinant human Oct4 protein. The MAb reacts specifically with human Oct4.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M221: Anti-Human Oct4, Monoclonal

MK139Pig Gla-Osteocalcin EIA Kit96 Rxns*

The Pig Gla-Osteocalcin EIA Kit is a quantitative kit that enables specific and highly sensitive assay of porcine Gla-osteocalcin that exhibits a potential to osseointegration (active osteocalcin). The capture antibody (plate-bound antibody) is a plate-bound solid-phased monoclonal antibody that specifically recognizes the Gla residue at position 17 on osteocalcin. It is paired with a labeled antibody—a monoclonal antibody for detecting porcine osteocalcin. The concurrent measurement of undercarboxylated porcine osteocalcin (Glu-osteocalcin) may be achieved with the Pig Glu-Osteocalcin EIA Kit (Cat. #MK149) to monitor both bone formation and bone resorption based on a relative evaluation of Gla/Glu-osteocalcins.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK139: Pig Gla-Osteocalcin EIA Kit

M149Polyclonal Antibody to Human Influenza A, B (Rabbit Polyclonal)0.4 mg*

Influenza virus is classified into three groups (A, B, and C). Clinically prevalent types of Influenza virus are H1, H3 and B strain. Influenza virus is further classified into subtypes based on variances in Neuraminidase (NA) and Haemagglutinin (HA) that are the surface glycoprotein of the virus. H1N1 subtype and H3N2 subtype are known to cause severe febrile illness. An influenza virus particle consists of a head region and a stem region. The head region has a receptor domain and the stem region contains a region required for fusion between the virus and the target cell. Takara offers several influenza antibodies that are useful for various viral detection and typing methods, as well as neutralization assays. These antibodies are for research use only.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components

M202Polyclonal Antibody to Human L7/Pcp20.2 mg*

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a rabbit polyclonal antibody raised against C-terminal region peptide [TALGF RRNSS PQPPT QAP] of human L7/Pcp2 (a marker of the purkinje progenitor cells in brain and nervous system) conjugated with KLH.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components

M196Polyclonal Antibody to Mouse Emx1100 uL*

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a guinea pig polyclonal antibody raised against C-terminal region peptide [ESEQK KKGSH HINRW RIATK QANGE DIDVT SND] of mouse Emx 1 (Empty spiracles homeobox 1; marker of embryonic development in cerebral cortex neurons) conjugated with KLH.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Amino acid alignment of the C-terminal regions of several Emx1 homologs

Amino acid alignment of the C-terminal regions of several Emx1 homologs.

Back

Immunohistochemical Staining with Polyclonal Antibody to Mouse Emx1 (Cat

Immunohistochemical Staining with Polyclonal Antibody to Mouse Emx1 (Cat. No. M196). Tissue: Embryonic mouse, 10.5 days (E10.5), sagittal section of telencephalon, dorsal region located at top. Fixation: 4% paraformaldehyde. Permeabilization: 0.3% Triton X-100 in PBS. Blocking: 2% skim milk in PBS.

M194Polyclonal Antibody to Mouse L7/Pcp2100 uL*

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. L7/Pcp2 is a rabbit polyclonal antibody raised against C-terminal region peptide [AALSF RRNSS PQPQT QAP] of mouse L7/Pcp2 (a marker of the purkinje progenitor cells in brain and nervous system) conjugated with KLH.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Alignment of C-terminal amino acid sequence of mouse, human, bovine, rat, and pig L7/Pcp2 homologs

Alignment of C-terminal amino acid sequence of mouse, human, bovine, rat, and pig L7/Pcp2 homologs.

Back

Immunohistochemical staining with Polyclonal Antibody to Mouse L7/Pcp2Postnatal (Cat

Immunohistochemical staining with Polyclonal Antibody to Mouse L7/Pcp2Postnatal (Cat. No. M194). Tissue: 1-day-old mouse cerebellum, sagittal section. Fixation: 4% paraformaldehyde. Permeabilization: 0.3% Triton X-100 in PBS. Blocking: 2% skim milk in PBS.

Back

Immunohistochemical detection of neural progenitor cells in mouse cerebellum

Immunohistochemical detection of neural progenitor cells in mouse cerebellum. A section of formalin-fixed paraffin-embedded mouse cerebellum tissue was stained with an anti-L7/Pcp2 antibody (Cat. # M194). Takara POD Conjugate Anti Rabbit, For Mouse Tissue (Cat. # MK202) was used in place of a traditional secondary antibody, and Takara DAB Substrate (Cat. # MK210) was used for detection. The image shown is 100X magnification.

M195Polyclonal Antibody to Mouse Otp100 uL*

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. Otp is a guinea pig polyclonal antibody raised against C-terminal region peptide [LRRKA LEHTV SMSFT] of mouse Otp (homeobox protein Orthopedia; a marker of the hindbrain and hypothalamic neurons during embryonic development ) conjugated with KLH.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

Alignment of the C-terminal amino acid sequences of several homologs of Otp

Alignment of the C-terminal amino acid sequences of several homologs of Otp.

Back

Immunohistochemical Staining with Polyclonal Antibody to Mouse Otp (Cat

Immunohistochemical Staining with Polyclonal Antibody to Mouse Otp (Cat. No. M195) and DAPI. Tissue: Embryonic mouse, 13.5 days (E13.5), hypothalamus, hindbrain, rostral. Fixation: 4% paraformaldehyde, 6 h. Permeabilization: 0.3% Triton X-100 in PBS. Blocking: 2% skim milk in PBS. .

M198Polyclonal Antibody to Mouse Otx2100 uL*

Antibody to neural progenitor cells; detects neurogenesis biomarkers. Use for embryogenesis and stem cell research. This is a rabbit polyclonal antibody raised against C-terminal region peptide [CGSYL TPMHH QLPGP GATLS PMGTN] of mouse Otx2 [Orthdenticle homeobox 2; a marker of the most upstream transcription factor that controls the differentiation of the forebrain and the retinal photoreceptor cells (cone cells and rod cells) in embryonic development] conjugated with KLH.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Image Data

Back

Immunohistochemical Staining with Polyclonal Antibody to Mouse Otx2 (Cat

Immunohistochemical Staining with Polyclonal Antibody to Mouse Otx2 (Cat. No. M198) and DAPI. Tissue: Embryonic mouse, day 10 (E10), forebrain to midbrain. Fixation: 4% paraformaldehyde, 6 h. Permeabilization: 0.3% Triton X-100 in PBS. Blocking: 2% skim milk in PBS. Blue, DAPI stain; red, anti-Otx2 antibody.

Back

Alignment of the C-terminal amino acid sequences of several Otx2 homologs

Alignment of the C-terminal amino acid sequences of several Otx2 homologs.

M176Polyclonal Anti-Dentin Matrix Protein-I (DMP-1)0.1 mg*

This product is a rabbit polyclonal antibody raised against an N-terminal region of rat Dentin Matrix Protein-1.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Resources

M173Polyclonal Anti-Mouse Osteocalcin (Clone mOC(1-20))0.1 mg*

This product was raised against N-terminal peptide of mouse osteocalcin, and specifically recognizes mouse osteocalcin. It does not cross react with rat osteocalcin.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Resources

M142Polyclonal Anti-N-cadherin0.4 mg*

Cadherins are transmembrane glycoproteins of 723–747 amino acids that function as Ca2+-dependent adhesion receptors and are responsible for tight intercellular connections. Members of the cadherin family include: E- (epithelial), P- (placental), and N- (neural) cadherin, which share a common basic structure but show distinct patterns of expression in tissues. The specific binding properties of each member controls selective cell-to-cell adhesion. Regulated expression of the members during development implicates involvement in morphogenesis. Cadherins may also be involved with tumor invasion and metastasis. MAb clones originate from relevant hybridoma cells constructed by fusion between splenocytes of immunized hosts and P3-X63-Ag8 myelomas. This polyclonal antibody was purified from serum-free culture supernatant.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M142: Anti-N-cadherin, Polyclonal

MK101Procollagen Type I C-Peptide (PIP) EIA Kit96 Assays*

The Procollagen Type I C-peptide EIA Kit is an in vitro enzyme immunoassay (EIA) kit for the quantification of human, bovine, canine, horse, or monkey PIP in plasma, serum, cultured cell extracts, cell culture supernatants, or other biological fluids.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components You May Also Like Image Data Resources

Back

Typical Procollagen Standard Curve

Typical Procollagen Standard Curve. A standard solution containing 640 ng PIP/mL was used to generate a standard curve. A dilution series was prepared by mixing the standard solution and sample diluent. Standard curves should be generated for each assay.

Back

Measurement of PIP in cultured supernatant of several cell lines (background levels in media will differ between FCS batches)

Measurement of PIP in cultured supernatant of several cell lines (background levels in media will differ between FCS batches). Note: measurement with this kit may be shifted if it is performed with samples which include animal serum such as Fetal Bovine Serum and Horse Serum. It is recommended to perform the measurement under serum-free conditions.

Back

Experimental Example: Stimulation of Collagen Synthesis by TGF-beta

Experimental Example: Stimulation of Collagen Synthesis by TGF-beta. MG63 osteosarcoma cells were cultured in the presence or absence of TGF-beta. PIP levels were measured using Cat.# MK101.

Back

MK101: Procollagen Type I C-Peptide (PIP) EIA Kit

MK126Rat Gla-Osteocalcin High Sensitive EIA Kit96 Rxns*

Rat Gla-Osteocalcin High Sensitive EIA Kit is a sandwich-type EIA kit which uses a rat osteocalcin C-terminus-specific antibody as capture-antibody on a solid-phase plate. This antibody has a minimal cross reactivity with bovine, human and rabbit osteocalcin. An enzyme-labeled antibody (GlaOC4-30) specific to Gla-OC is used as the detection antibody, allowing this kit to detect Gla-osteocalcin with a very high sensitivity. As such, this EIA kit is sensitive enough to detect even minute levels of rat osteocalcin produced in supernatants of cells cultured in fetal calf serum-supplemented medium.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK126: Rat Gla-Osteocalcin High Sensitive EIA Kit

MK146Rat Glu-Osteocalcin High Sensitive EIA Kit96 Rxns*

Rat Glu-Osteocalcin High Sensitive EIA Kit is a sandwich-type EIA kit in which rat osteocalcin C terminal region recognition specific antibody is the capture antibody on a solid plate and a monoclonal antibody that is specific to the Glu residues that straddle positions 21 and 24 of osteocalcin is arranged as the detection antibody. This product makes high-sensitivity measurement of minor antigens and maintenance of stable reproducibility possible. The use of a 96-well plate makes it possible to assay many sample treatments. Moreover, as it has the same capture antibody as the Rat Gla-Osteocalcin High Sensitive EIA Kit (Cat. #MK126), the kits may be used together for simultaneous Gla/Glu detection, thereby making simultaneous monitoring of bone formation and resorption possible.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK146: Rat Glu-Osteocalcin High Sensitive EIA Kit

M223Sox2 (Human), Monoclonal0.1 mg*

This product was raised against the KLH-conjugated peptide from human Sox2 sequence (amino acid 219–236: GSPTYSMSYSQQGTPGMA). The antibody specifically reacts with human Sox2.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

M223: Sox2 (Human), Monoclonal

Y40400STEM101™50 ug*

STEM101 reacts specifically with a protein located in the nucleus of human cells. This antibody detects cells from a variety of human tissues including brain. This antibody does not cross-react with brain tissue or extracts from mouse or rat.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

STEM101 detects nuclei of transplanted human neural stem cells in the olfactory bulb of a mouse brain

STEM101 detects nuclei of transplanted human neural stem cells in the olfactory bulb of a mouse brain.

Back

Y40400: STEM101

Y40410STEM121™50 ug*

STEM121 reacts specifically with a cytoplasmic protein of human cells. This marker is expressed in cells from a variety of tissues including brain, liver and pancreas. However, it is expressed most highly in central nervous system (CNS) cells. This antibody does not cross-react with brain tissue or extracts from mouse, rat, or cynomologous monkey.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

STEM121 detects migration and differentiation of transplanted human neural stem cells in the hippocampus of a mouse brain

STEM121 detects migration and differentiation of transplanted human neural stem cells in the hippocampus of a mouse brain.

Back

STEM121 detects presence of transplanted human liver engrafting cells in a mouse liver

STEM121 detects presence of transplanted human liver engrafting cells in a mouse liver.

Back

Y40410: STEM121

Y40420STEM123™50 ug*

STEM123 reacts specifically with glial fibrillary acidic protein (GFAP) of human cells. GFAP is an intermediate-filament protein that is highly expressed in astrocytes and other cells of astroglial lineage. This antibody does not cross-react with brain tissue or extracts from mouse or rat.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

STEM123 detects human GFAP+ astrocytes differentiated from human neural stem cells after transplantation into a mouse brain

STEM123 detects human GFAP+ astrocytes differentiated from human neural stem cells after transplantation into a mouse brain.

Back

STEM123 detects human GFAP+ astrocytes differentiated from human neural stem cells in vitro

STEM123 detects human GFAP+ astrocytes differentiated from human neural stem cells in vitro.

MK301TRACP and ALP Assay Kit500 Rxns*

TRACP & ALP Assay Kit allows for simultaneous detection of 2 enzymes which are involved in bone metabolism. TRACP which is an osteoclast enzyme marker and ALP an osteoblast enzyme marker. TRACP & ALP Assay Kit has been designed for simple and quick detection of ACP (Acid phosphatase) and ALP (Alkaline phosphatase) through the use of pNPP (p-nitro-phenyl phosphate) substrate. The addition of tartaric acid into the ACP assay, allows for the detection of TRACP (tartrate-resistant acid phosphatase) activity. Since this kit utilizes an aqueous substrate, it enables quick activity quantification by measuring the absorbance of the reactant. In addition to this kit, TRACP & ALP double-staining Kit (Cat. #MK300) is also available using a non-soluble substrate. The appropriate kit can be selected depending on assay interest.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK301: TRACP and ALP Assay Kit

MK300TRACP and ALP Double-Stain Kit120 Wells*

This product is a staining kit for bone-related cells. Chromogenic substrates for alkaline phosphatase, an enzyme marker of osteoblasts, and tartrate-resistant acid phosphatase, an enzyme marker of osteoclasts, are combined with a reagent for nuclear staining that provides visualization of multinucleated osteoclasts. Both acid and alkaline phosphatase activities in the cells can be stained simultaneously for comparison. Moreover, as the substrates are provided as premixed reagents, the substrate solutions can be easily prepared.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

Human bone marrow mononuclear cells were cultured in the presence of Macrophage Colony Stimulating Factor (+M-CSF) and +Vitamin D3

Human bone marrow mononuclear cells were cultured in the presence of Macrophage Colony Stimulating Factor (+M-CSF) and +Vitamin D3. TRACP activity staining was carried out after cells were differentiated on day 9 of the culture.

Back

Human bone marrow mononuclear cells were cultured in the presence of Macrophage Colony Stimulating Factor (+M-CSF)

Human bone marrow mononuclear cells were cultured in the presence of Macrophage Colony Stimulating Factor (+M-CSF). ALP activity staining was carried out after cells were differentiated on day 9 of the culture.

MK118Undercarboxylated Osteocalcin (Glu-OC) EIA Kit96 Rxns*

The Undercarboxylated Osteocalcin (Glu-OC) EIA Kit uses two monoclonal antibodies that are highly specific for undercarboxylated osteocalcin (Glu-OC); one of these antibodies is attached to the assay plate and the other is peroxidase-linked. Direct measurement of Glu-OC by the Undercarboxylated Osteocalcin (Glu-OC) EIA Kit provides accurate bone metabolism data without the need for radioactivity. Furthermore, the Undercarboxylated Osteocalcin (Glu-OC) EIA Kit can be used in conjunction with the Gla-Type Osteocalcin (Gla-OC) EIA Kit (Cat. #MK111) to obtain more complete bone metabolism data.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data

Back

MK118: Undercarboxylated Osteocalcin (Glu-OC) EIA Kit

MK410Universal Tyrosine Kinase Assay Kit96 Assays*

Universal Tyrosine Kinase Assay Kit enables measurement of the activity of PTK over a wide range, quickly and specifically and with non-RI chemicals. This kit is useful for analysis of the regulation of PTK activity by using recombinant PTK and for the in vitro screening of PTK inhibitors.

Notice to purchaser

Our products are to be used for Research Use Only. They may not be used for any other purpose, including, but not limited to, use in humans, therapeutic or diagnostic use, or commercial use of any kind. Our products may not be transferred to third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to third parties without our prior written approval.

Documents Components Image Data Resources

Back

Principle of the Universal Tyrosine Assay Kit

Principle of the Universal Tyrosine Assay Kit.