Thermo Fisher Scientific HK2 Polyclonal Antibody
Human HK2 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 적합합니다. 합성 펩타이드(460–497aa)를 면역원으로 사용하였으며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Hexokinase II (460–497aa: AYRLADQHRARQKTLEHLQLSHDQLLEVKRRMKVEMER) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | −20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746480 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
In vertebrates, there are four major glucose-phosphorylating isoenzymes: hexokinase I, II, III, and IV. Hexokinase catalyzes the phosphorylation of glucose to produce glucose-6-phosphate, the first step in glycolysis. Hexokinase 2 is the predominant isozyme expressed in insulin-responsive tissues such as skeletal muscle. Its expression is insulin-responsive and is implicated in the elevated glycolysis observed in rapidly growing cancer cells.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific HNF4A Polyclonal Antibody
544,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HNF1A Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HK2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HO-1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HMGB4 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|