Merck Anti-ZBED9 antibody produced in rabbit
다른 상품 둘러보기
Anti-ZBED9 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-ZFP38-L, Anti-KIAA1925, Anti-ZNF305P2, Anti-SCAND3, Anti-ZNF452, Anti-FLJ31087, Anti-Buster4
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
SAFSSEAKLGLSHSQLTEELVASLHTENELDQADKELENTLRAQYEENIETGTDSSDIEENLSVTPKVAEKSPPESRLRFLSCVVCEKECTGVNSCISCDGNIHAICGVPSQHGTEGCGRQITCSLCYETSTMK
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SCAND3(114821)
SCAND3 (SCAN domain containing 3) is a mammalian regulatory protein that is widely expressed in vertebrate tissues. It performs in various cellular functions in vertebrates. It possesses a DDE-like cellular integrases (C-INTs) core flanked at the N-terminus end by a SCAN zinc-finger domain and a TPase-derived hATd dimerization module at the C-terminus. It is originated from GINGER2, a superfamily of cut-and-paste transposons.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|