
Merck Anti-HDHD5 antibody produced in rabbit
Rabbit polyclonal anti-HDHD5 antibody for human detection. Affinity isolated and unconjugated, suitable for immunoblotting, immunofluorescence, and immunohistochemistry. Supplied as buffered aqueous glycerol solution, stored at −20°C.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-HDHD5 antibody produced in rabbit
Anti-HDHD5 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution.
Anti-CECR5 (Cat eye syndrome critical region protein 5 precursor) antibody produced in rabbit.
생물학적 정보
- Source: Rabbit
- Clonality: Polyclonal
- Conjugation: Unconjugated
- Form: Buffered aqueous glycerol solution
- Species Reactivity: Human
- Product Line: Prestige Antibodies® Powered by Atlas Antibodies
- Antibody Type: Primary antibody
품질 및 포장
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| Packaging | Small pack, 25 μL |
| Storage Temperature | −20°C |
| Shipping Condition | Wet ice |
적용 기술
| Technique | Working Concentration |
|---|---|
| Immunoblotting | 0.04–0.4 μg/mL |
| Immunofluorescence | 0.25–2 μg/mL |
| Immunohistochemistry | 1:50–1:200 |
면역원 서열
GTFLLCLETIYQKVTGKELRYEGLMGKPSILTYQYAEDLIRRQAERRGWAAPIRKLYAVGDNPMSDVYGANLFHQYLQKATHDGAPELGAGGTRQQQPSASQSCISILVCTGVYNPRNPQSTEPVLGGGEPPFHGHRDLCFSPGLMEASHVVNDVNEAVQLVFRKEG
유전자 정보
Human Gene: CECR5 (27440)
CECR5 (cat eye syndrome chromosome region, candidate 5) is located on chromosome 22q11.2.
Alternative splicing produces two different transcripts (393 and 423 amino acids).
The proteins show sequence similarity to Schizosaccharomyces pombe CDP-alcohol phosphatidyl transferase and Caenorhabditis elegans phosphatidyl synthase-like gene.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



