CacheBy
Merck Anti-CGRRF1 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-CGRRF1 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-CGRRF1 다클론 항체로, 인간 CGRRF1 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품으로 Western blot, IF, IHC 등에 적합합니다. Affinity isolated 형식이며 −20°C에서 보관합니다.

브랜드
Merck Sigma
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Merck HPA002930-100UL Anti-CGRRF1 antibody produced in rabbit, 100uL pk판매 단위 pk
재고 확인 필요
920,800원VAT 포함 1,012,880원

Merck Sigma · Merck Anti-CGRRF1 antibody produced in rabbit

Anti-CGRRF1 antibody produced in rabbit

제품 설명

Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution

본 항체는 Cell growth regulator with RING finger domain protein 1 (CGRRF1, RING finger protein 197, Cell growth regulatory gene 19 protein)을 인식하는 토끼 유래 다클론 항체입니다.

제품 정보

항목 내용
Biological source Rabbit
Quality Level 100
Conjugation Unconjugated
Antibody form Affinity isolated antibody
Antibody type Primary antibodies
Clone Polyclonal
Product line Prestige Antibodies® Powered by Atlas Antibodies
Form Buffered aqueous glycerol solution
Species reactivity Human
Packaging Small pack of 25 μL
Techniques Immunoblotting: 0.04–0.4 μg/mL
Immunofluorescence: 0.25–2 μg/mL
Immunohistochemistry: 1:200–1:500
Immunogen sequence IYDIISMVSVIHIPDRTYKLSCRILYQYLLLAQGQFHDLKQLFMSANNNFTPSNNSSSEEKNTDRSLLEKVGLSESEVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALCSQKEQDKDKPK
UniProt accession no. Q99675
Shipping conditions Wet ice
Storage temperature −20 °C
Gene information Human CGRRF1 (Gene ID: 10668)

추가 정보

Cell growth regulator with RING finger domain protein 1 recombinant protein epitope signature tag (PrEST)

Merck Sigma 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.