Merck Anti-ST6GAL2 antibody produced in rabbit
다른 상품 둘러보기
Anti-ST6GAL2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Beta-galactoside alpha-2,6-sialyltransferase 2, Anti-Alpha 2,6-ST 2, Anti-hST6Gal II, Anti-CMP-N- acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2, Anti-ST6Gal II, Anti-ST6GalII, Anti-ST6Gal-II, Anti-Sialyltransferase 2
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
PSSLSFLETRRLLPVQGKQRAIMGAAHEPSPPGGLDARQALPRAHPAGSFHAGPGDLQKWAQSQDGFEHKEFFSSQVGRKSQSAFYPEDDDYFFAAGQPGWHSHTQGTLGFPSPGEPGPREGAFPAAQ
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ST6GAL2(84620)
The gene ST6GAL2 (ST6 β-galactosamide α-2,6-sialyltranferase 2) belongs to the ST6Gal family that also includes another member, ST6Gal I. It is mainly expressed in embryonic and adult brain. It is also found to be expressed in small intestine and colon. The encoded protein is found to be 529 amino acids long and exhibits 48.9% amino acid sequence similarity with ST6Gal I. The ST6GAL2 gene is mapped to human chromosome 2q11.2-q12.1. It consists of eight exons spanning a length of 85kb. The protein contains type II transmembrane topology. All sialyltransferases of animal origin contain a short N-terminal tail that is cytoplasmic, a transmembrane domain, a stem region, and a catalytic domain with highly conserved motifs called sialylmotifs.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|