Merck Anti-TMED9 antibody produced in rabbit
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA014650-100UL | - | Merck HPA014650-100UL Anti-TMED9 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 868,530원 | - | 955,383원 |
다른 상품 둘러보기
Anti-TMED9 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-HSGP25L2G, Anti-p24a2, Anti-p24alpha2
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, rat
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
GETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... TMED9(54732)
TMED9 (transmembrane emp24 protein transport domain containing 9) belongs to a family of widely present, small, type I transmembrane proteins called p24 proteins. This family can be divided into four subfamilies namely, p23 or δ, p24 or β, p25 or α, and p26 or γ. TMED9 is also called p25 and is the only member of the p25 subfamily in mammals. It localizes to endoplasmic reticulum and _cis_-Golgi network (CGN). Its C-terminal is small and faces the cytoplasm and contains degenerate sorting motifs. It has a coiled-coil domain in its extracellular domain. It also contains a KKXX ER-retrieval motif.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|