Merck Anti-ZDHHC6 antibody produced in rabbit
다른 상품 둘러보기
Anti-ZDHHC6 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Palmitoyltransferase ZDHHC6, probable, Anti-Zinc finger DHHC domain-containing protein 6, Anti-DHHC-6, Anti-Transmembrane protein H4, Anti-Zinc finger protein 376
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:500- 1:1000
면역원 서열
QLYHRLSFGWNTVKIDMSAARRDPLPIVPFGLAAF
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ZDHHC6(64429)
The gene ZDHHC6 (zinc finger DHHC-type containing 6) encodes a transmembrane enzyme containing a conserved cytosolic DHHC domain and is expressed mainly in the brain, uterus, kidney, lung, colon, thymus and small intestine. The gene is mapped to human chromosome 10q25.2 and contains nine exons.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.