
Merck Anti-KIDINS220 antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-KIDINS220 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Ankyrin repeat-rich membrane spanning protein, Anti-Kinase D-interacting substrate of 220 kDa
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
EPLLEIDGDIRNFEVFLSSRTPVLVARDVKVFLPCTVNLDPKLREIIADVRAAREQISIGGLAYPPLPLHEGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... KIDINS220(57498)
KIDINS220 (kinase D-interacting substrate, 220kDa) is a newly discovered protein, which has a predominant expression in the developing nervous system. This gene is localized to human chromosome 2q. The encoded protein is of 22kDa, and is composed of three functional domains. One domain acts as a scaffold for MAPK/ERK (extracellular signal-regulated kinase (ERK) kinase) signaling cascade, and also interacts with Trk, Eph, and VEGF (vascular endothelial growth factor). It has a kinesin binding domain, which also interacts with microtubule associated proteins (MAPs). The last domain is an ankyrin rich domain, present in the N-terminal and interacts with Trio, which is a RhoGEF. It has four transmembrane regions, and both N- and C-termini face the cytoplasm.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-GPR149 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-VPS9D1 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-KIDINS220 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-SNN antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-TNFRSF14 antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
