Anti-RET antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Ret Antibody, Anti-MTC1, RET Antibody - Anti-RET antibody produced in rabbit, Anti-CDHR16, Anti-MEN2B, Anti-MEN2A, Anti-RET51, Anti-HSCR1, Anti-CDHF12, Anti-PTC
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... RET(5979)
Proto-oncogene tyrosine-protein kinase receptor Ret (RET) is a receptor for the glial derived neurotrophic factor (GDNF) family of ligands. RET gene codes for the RET receptor protein. RET is predominantly found in the plasma membrane and the cytoplasm. It is mainly expressed in neural tissues, neuroendocrine cells, the digestive tract, adult kidneys, skin, and blood apparatus. RET has an extracellular region, a transmembrane region, and a cytoplasmic region. It also has four cadherin-like domains, a cysteine-rich domain, and calcium-binding sites. RET gene is located on human chromosome 10q11.21.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|