Merck Anti-PLPPR1 antibody produced in rabbit
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA014968-100UL | - | Merck HPA014968-100UL Anti-PLPPR1 antibody produced in rabbit, 100uL pk | 재고문의 | 0 | pk | 895,600원 | - | 985,160원 |
다른 상품 둘러보기
Anti-PLPPR1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-FLJ20300, Anti-LPPR1, Anti-PRG-3, Anti-MGC26189
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
KSTRESLIAQEKTILTGECCYLNPLLRRIIRF
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... PLPPR1(54886)
LPPR1 (lipid phosphate phosphatase-related protein type 1) is also called plasticity-related gene-3 (PRG-3), and belongs to a family of phospholipid ectophosphatases called PRG. It is predominantly expressed in the brain and shows a development specific pattern. In developing brain, it is expressed in the layer of neuronal cells, and in the mature brain, it is expressed primarily in cerebellum and hippocampus. This protein consists of six transmembrane domains, and its active site faces the extracellular region.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|